SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010384 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010384
Domain Number 1 Region: 309-485
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-24
Family DBL homology domain (DH-domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010384   Gene: ENSMPUG00000010460   Transcript: ENSMPUT00000010551
Sequence length 775
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897010.1:5886700:5944339:1 gene:ENSMPUG00000010460 transcript:ENSMPUT00000010551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKTKTKQGENEHMPMNNPSTQIYQASKYKSSLNLPPVGARLQRQDGGIITSLEQLHEKI
NEMRNVFNSLENKLQALASELKTGFTEAMQELSRIQHGEYALEEKVKSCRCSMEEKVTEM
KNSLNYFKEELSNAMSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKAKKTQKEEHGSQA
GPAQAQGSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSMHVADSNVKGMMGPGMNP
TTPEAEENLKSCLSADIQPKSHLSSGVWRQPKDVKEWGEEYVTKDHPDKLKDAGQGRHSS
LENVLCETSLAAKRQTVALELLESERKYVINISLILKIKATFQGSDGKRNSKERSLFPGS
LRYLVQQHLDLLHALQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVAYLRDLPECISLV
HVVVLKEGDEEIKSDIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDYYLLLVCVQRLRV
FISHYTLLFQCNEDLLIQKRKKLKKSSMAKLYKGLASQCANTGQDASPTTGPEAVRDSGI
HSEEILQPYPSAPSSGPAVTHLMPPVKKSQQQQSLMESMQPGKPSEWEMEGRKHERPESL
LAPAQFCAAEQDVKALAGPLQAIPEMDFEPSPAEPLGNVERSLRAPAELLPDARGFVPAG
YEEFEYGGEIFALPAPYDEEPFQAPALFENCSPASSESSLDICFLRPVSFAMEAERPEHP
LQPLPKSATSPAGSSSAYKLEAAAQAQGKAKPXXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3YGC7
ENSMPUP00000010384 ENSMPUP00000010384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]