SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010395 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010395
Domain Number 1 Region: 510-986
Classification Level Classification E-value
Superfamily Ras GEF 7.98e-142
Family Ras GEF 0.0000000000000112
Further Details:      
 
Domain Number 2 Region: 141-343
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-43
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 3 Region: 1-120
Classification Level Classification E-value
Superfamily Histone-fold 8.8e-41
Family TBP-associated factors, TAFs 0.00000202
Further Details:      
 
Domain Number 4 Region: 361-516
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-39
Family Pleckstrin-homology domain (PH domain) 0.000000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010395   Gene: ENSMPUG00000010472   Transcript: ENSMPUT00000010563
Sequence length 1276
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897010.1:5968559:6050722:-1 gene:ENSMPUG00000010472 transcript:ENSMPUT00000010563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEV
LGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
QDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLF
SANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYES
YARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELL
KQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQL
AIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQ
PRLPGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNW
MAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAG
IPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTE
ADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEF
IGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLL
TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEK
CIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ
KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIE
PRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTA
SAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVSLPHGPRSASVSS
ISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYS
ISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFT
PPPPQTPSPHGTRRHLPSPPLTQEVDLPSITGPPVPPRQSTSQHIPKLPPKTYKREHTHP
SMHRDGPPLLENAHSS
Download sequence
Identical sequences M3YGD8
ENSMPUP00000010395 ENSMPUP00000010395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]