SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010404 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010404
Domain Number 1 Region: 306-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-71
Family Nuclear receptor ligand-binding domain 0.000000000489
Further Details:      
 
Domain Number 2 Region: 183-262
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-28
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010404   Gene: ENSMPUG00000010481   Transcript: ENSMPUT00000010572
Sequence length 597
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896937.1:11878337:12173208:1 gene:ENSMPUG00000010481 transcript:ENSMPUT00000010572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTLHTKASGMALLHQIQGTELEPLNRPQLKIPLERPLGEVYVDSSKPAVYNYPEGGAY
DFNAAPAASAPVYGQSGLSYGPGSEAAAFGANGLGGFQPLNSVSPSPLVLLHPPPQLSPF
LHPHGQQVPYYLENEPSGYAVHEAGPPAFYRPNSDSRRQGGRERLASTSDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDAEGRNEVGSSGDMRTSNLWPSPLLIKH
TKKNSPALSLTADQMVSALLEAEPPIIYSDYDPSRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLSLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPAGRGGGSAPMEEMSESQLATTGATSSHSLQAYYITEEAASFPSTV
Download sequence
Identical sequences M3YGE7
ENSMPUP00000010404 XP_012912196.1.14098 ENSMPUP00000010404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]