SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010406 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000010406
Domain Number - Region: 11-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010406   Gene: ENSMPUG00000010483   Transcript: ENSMPUT00000010574
Sequence length 253
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897129.1:1954246:1967156:1 gene:ENSMPUG00000010483 transcript:ENSMPUT00000010574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIITKLKEQHSKIDMVHRNSSEGFFLDASRHIFEASQHGLERRHLEANQNELQAHVDQIT
EMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDMSESSSLS
ALVTNSDLSLRKS
Download sequence
Identical sequences M3YGE9
XP_004405364.1.74151 XP_004776458.1.14098 XP_004776459.1.14098 ENSMPUP00000010406 ENSMPUP00000010406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]