SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010408 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010408
Domain Number 1 Region: 11-149,180-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-74
Family Calponin-homology domain, CH-domain 0.0000337
Further Details:      
 
Domain Number 2 Region: 8046-8201
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 1618-1751
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-19
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 8425-8539
Classification Level Classification E-value
Superfamily Spectrin repeat 9.07e-19
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 7826-7950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-18
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 6965-7110
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-17
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 7 Region: 4500-4657
Classification Level Classification E-value
Superfamily Spectrin repeat 4.88e-17
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 8 Region: 7418-7549
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-16
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 9 Region: 3326-3448
Classification Level Classification E-value
Superfamily Spectrin repeat 1.88e-16
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 10 Region: 3110-3234
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000154
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 11 Region: 7090-7221
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000419
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 6754-6894
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000116
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 13 Region: 2452-2581
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000158
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 14 Region: 5055-5198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000196
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 15 Region: 1397-1533
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000204
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 16 Region: 3754-3875
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000309
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 17 Region: 4282-4438
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000432
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 18 Region: 3882-4022
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000916
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 19 Region: 550-690
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000374
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 3560-3692
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000445
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 21 Region: 7616-7767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000166
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 22 Region: 7341-7452
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000275
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 23 Region: 7954-8064
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000032
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 24 Region: 2240-2395
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000364
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 25 Region: 5725-5802,5913-5959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000407
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 26 Region: 2670-2796
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000129
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 27 Region: 5923-6061
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000134
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 28 Region: 2820-2937
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 8501-8648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000514
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 30 Region: 4951-5068
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000072
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 31 Region: 2043-2182
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000798
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 32 Region: 1079-1219
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000139
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 33 Region: 1721-1858
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000165
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 1509-1613
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000036
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 35 Region: 3475-3586
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000388
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 36 Region: 5470-5586
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000403
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 37 Region: 3025-3123
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000816
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 38 Region: 5162-5272
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000187
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 39 Region: 1916-2067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000623
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 40 Region: 3237-3339
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000828
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 41 Region: 6549-6632
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000135
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 42 Region: 4199-4327
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 43 Region: 5581-5681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 44 Region: 873-1006
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000288
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 45 Region: 3994-4126
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000013
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 46 Region: 6372-6477
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 47 Region: 5262-5404
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000432
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 48 Region: 6071-6186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000461
Family Spectrin repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010408
Domain Number - Region: 4870-4980
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000122
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number - Region: 6681-6791
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number - Region: 4653-4767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00222
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 2588-2660
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010408   Gene: ENSMPUG00000010485   Transcript: ENSMPUT00000010576
Sequence length 8754
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896937.1:12181820:12655283:-1 gene:ENSMPUG00000010485 transcript:ENSMPUT00000010576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRTASRSPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPLAVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMYRGSPIKLVNINSTD
IADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSGSTSSVDSTVSAETASPPSKRKVA
TKIQGNAKRALLKWVQYTVAKQTGIEVKDFGRSWRSGLAFHSIIHAIRPELVDLERVKGR
PNRENLAEAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNTGTDGQ
ETDREDRLILKEAKVWIEQFERDLTRAQMTESNLQDKYQSFKHFRVQYELKRKQIEHLIQ
PVHRDGKLSLDQALVKQSWDRVSSRLFDWHIQLDKSLPAPLGTIGAWLYRAEVALREEIT
IQQVHEETANTIQRKREQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFH
FVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVELLLQNYISFIENT
KFFEQYEVTYQILKQTAEMYVQADGSVEEAENVMKFMNETTAQWRNLSVEVRSVRSMLEE
VIANWDRYGNTVASLQAWLEDAEKMLNQSEHAKKDFFRNLPHWIQQHAAMNDAGNFLIET
CDEMVSRDLKQQLLLLNGRWRELFMEVKQYARADEMDRMKKEYTDCVTALSDFATEALKK
MSEPLEVSFLNVKLLTQDLEDIEQRVPVMDAQYKMITKTAHLIAKESPQEEANEMFATMS
RLKEQLTKVKECHSPLLYESQQLLIPLEELEKQMTFFYDSLGKINEILTVLEHEAQSSAL
FKQKQQELSACQESCKKTMTQIEKGSQNVQKFVTLSSVLKHFDQTKLHRQIADAHGAFQN
MVKKIGDWKKHVETNSRLMKKFEESRAELEKVLRMAQEGLEEKGNPEDLLKRHTEFFSRL
DQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLLHLKIGVEKNR
FLASVEECRTELDREIKLVAQEGSENIIKEHRIFFSDKGPHHLCEKRLQLIEELCLKLPV
RDPVRNTPETCHATLRELRAAIDATYMKLMEDPDKWKDYSSRISEFSSWISAKETQLKAF
KSKPFDTANHGEVKRAVEEIRNGITTKGETLNWLKSRLKILIEVSSENEAQKQGDELAKL
SGSFKALAALLSEVEKMLSNFGDCVQYKEIVQSSLEDLISGSKEVQEQAEKILDTENLFE
AQQLLLHHQQKTKRISAKKRDVQQQVAQAQRGEGGLPDQAREELRKLESTLDHMEHSREK
QERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELEQTKEFSKRTE
GIAVQAENLVKEASEIPLGPKNKQLLQQQAKSIKEQVKKLEDTLEEDIKTMEMVKNKWDH
FGNNFETLSDWITEKEKELNALETSSSAMDMQIHQIKVTIQEIESKMSSITDLEEAAQSF
AQFVTTGESARIKAKLTQIRRYWEELREHAQCLEATILGHLSQQQKFEENLRKIQKSVSE
FEDKLADPLKICSSATETYKVLQEHMDLCQALEALSSVVATTSAGAQKVANGGSSVQEAA
ALQQRYEETRTRAKERQTALETLLAHWQRLEKELSTFLTWLERCEEIASSPEMDISADRV
KVESELQSIQALQNEVVSRASIYSSLLQLKESLFSVASKDDVKTMKVHLEQLDERWRDLP
QIINKRITFLQSAVAEHQQFDELLLSFSVWIKLFLSELQTTSEISITDHQAAFTRHKDHT
AEVESKKGELHSLRDHLVKLGALGRAENLPVLQGKAEDCFQLFEEASQVVERRQLALSQL
AEFLQSHASLSGVLHRLRHTVEATDRMSRKQSDLLEKDLNHAIQDAKALESAAISLDSVL
AKAQYHLKSGNSEQRTSCRTTADHLCSELERIQNLLGMKQSEADALAILKKAFQDQKEEL
LRSIEDIEERTDKERLKELTRQALQQRLRVFNQLEDELNSHEHELCWLKDKAKQIAQKDV
AFASEVDKEVNRLEVTWADTKKLIHENQGQCCGLIDLMREYQNLKSAVSKVLENASNVIA
TRNTIKDQEDLRWALSKHETVKNEMCNKQKELDNFTSKGKQLLSELKKIHSSDFILVKTD
MESTVDRWLDMSEKIEENMDRLRVSLTIWADVLSSKEEIDGWSNSSVPQLAESISHLNNS
VRAEEVLKEFETEVKNKALRLEELHCKVNDLKELTKNPETPPDLQFIEADLRQKLEHAKE
ITEEAKGTLKDFTAQSTQVEKCINDMTSWLAKVEESLMNCAQTKTWEGLRKVKEIQKELQ
SQQSNISSTQENLNSLCRKYHSVELESLGSALTGLIKNHEAVSQLCSKTQASLQDSLEKH
FSESMQEFQEWFSGIKAAAKASSDRTGDSKVLEAKLHDLQNILDSISDGQSKLDAVTQEG
QTLYAHVSKQIVSSIQEQITKANEEFQAFLKQCLRDKQALQDCALELGSFEDQHRKLNLW
IHEMNERLSTENLGESKQHIPEKKNEVHKVELFLGELLAARESLDKLSQRGQLLSEEGHG
AGKEGRLCSQLLTNYQNLLRTTKERLRSCQMALQEHEALEEALQSMWSWVKGIQDRLATA
ESTVGSKDTLEKRLLQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKQGQKVIQTQLQTL
KDVWADIMSSSVHAQSTLEAVIGKWSDYLEWKHQLEQWLESVDRKVAQPLQLQPGLKEKG
ALLDHFRSVVSEAEEHAAALQSLASKSRELFQKTEDESFKEAAQEELKTQFNDIITVSKE
KMRKVEEIVKDHLMYLDAVQEFTDWLHSAKEELHRWSDMSGDSSATQKKLSKIKELMDSR
EIGAGRLSRVELLAPAVKQNTSASGCELVDAEMQALRADWKQWEDSVLRTQTSLEDLVSQ
MALSEQEFSGQVAHLEQALGQFSALLSTWTQQLALLEGKNTDQEIVECWQKGQEILDALQ
KSEPKTEDLKSQLNELCRFSRDLSTYSGRVSGLIKEYNCLCLQASKGCQNREQILQQRFR
RAFKDFQQWLVNAKITTAKCFDIPQNISEVSASLQKIQEFLSESENGQHKLNTMLSKGEL
LSTVLPKEKAEGIQAKVATAKEDWKNFHSNLHQKESALENLKIQMKDFEVSAEPVQDWLS
KTEKLVQESSNRLYDLPAKRREQQKLQSVLEEINCYEPQLNRLREKAQQLWEGQAASKSF
MHRVSQLSAQYLALSNLTKEKVSRLDRIVAEHSQFSLGIKELQDWLTDAVHMLESYCHPT
SDKSVLDSRMLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIRALQQQLQSVKDMW
ASLSSAAIRCKSQLEGALSKWTSYQDDVRQFSSWMDSVEAGLNESERQYAELREKTTALG
KAKLLSEEVLSYSSLLETIELKGAGMTEHYVTQLEFQDLQERYRAIKERAKEAVTRSEKL
VRLHQEYQRDLKAFEVWLGQEQDKLDRHSVLEGDADSHETTLRHLQELQVRCAEGQALLN
SVLHAREEVIPSGIPQTEDRALESLRQDWQAYQQRLSETRTQFNNVVNKLRLMEQKYQQV
DEWLKTLESKVSVRTGRQSSRAAKEMQLHQMKKWHEEVTAYKDEVEEVGARAQEMLDESH
GSSRMGCQATQLTSRYQALLLQVLEQIKFLEEEIQSLEESELSLSSYSEWYSSTYKNFKN
VATKIDRVDKAMMGRKMKMLEGLLKDMEKGHGLLKSAREKGERALKYLEDGEAETLRKEI
QEHMEQLKELTGAVRKEHLTLEKGLLLAKEFSDKYKALTQWISEYQEILHTPEEPKMELY
EKKAQLSKYKSLQQVVLSHEPSVRSVREKGEALLELVQDITLKDEIDKLQSDYKDLCGAG
KEHVCSLEAKVRDHEDYNSELQEVEKGLLQMSGRLVAPDLMETSSLETITQQLAHHKAMM
EEIAGFEDRLNNLKMKGDNLISQCADHLQAKLKQNVHGHLQGTRDSYSAICSTAQRVYQS
LEHELQKHVSRQDTVQQCQAWLSAVQPDLQPSQHPPLSRAEAVKQVKHFRALQEQARTYL
DLLCSMCDLSNPSVKATAKDIQQTEQMIEQRLAQAQNLTQGWGEIKHMKAELWIYLQDAD
QQLQNMKRRHSELELNIAQNMVSQVKDFVKKLQCKQASMTTITERVNKLTKNQESPEHKE
ISHLNDQWLDLCHQSNNLCLQREEDLQRTRDYHDCMNVVEVFLEKFTTEWDNLARSDAES
TAVHLEALKKLALALQERKQAIEDLKDQKQKMIEHLNLDDKELVKEQTSHLEQRWFQLED
LVKRKIQVSVTNLEELNVVRSRFQELMEWAEEQQPNIAEALKQSPPPDTAQHLLLDHLSI
CSELEAKQMLLKSLIKDADRVMADLGLNERQIIQKALSEAQRHVNCLSDLVGQRRKYLNK
ALSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCKSAQASLKTYQNEV
TGLWAQGRELMKGVPEQEKSEVLSKLQELQSVYDTVLQKCSHRLQELEKNLVSRKHFKED
FDKACHWLKQADIVTFPEINLMNESPELHTQLAKYQHILEQSPEYETLLLTLQRTGQAML
PSLNEVDHSYLNEKLNALPLQFNVVVALAKDKFYKVQEAILARKEYGSLIELTTQSLSEL
EDQFLKMSKVPTDLRAEEALSLQDGYRALLGEVAGLGEAVDELNQKKETFRSTGQPWQPD
KMLHLVTLYHRLKRQTEQRVTFLEDTTSAYQEHEKMCHQLEKQLEAVKTEQSRVNEETLP
AEEKLKKYHSLAGNLQDLGIVLKRVTVHLEDLVPHLDPLAHEKAKQQIQSWQEELKRLTS
AIGATVTECESRMVQSIDFQTELSRSLDWLRSVKAELRGPVCLDLRLQDIQEEIRKIQIH
QEEVQSSLRILNALSNKEKEKFTKAKELISADLQHTLAELSELDGDVQEALRTRQAVLTQ
IYSQCQRYYQVSQAANDWLEDAHEMLQLAGNGLDVESAEENLKSHKEFFSTEDQFHSHLE
ELQGLVASLDPLIKPTGKEDLAQKMASLEEKSQRRIQDSHAHLDLLQRCSAQWQDYQKAR
EEVIELMNDAEKKLSEFSLSKTSSSHEAEGKLSEHKSLVSLVNSFHEKVVALEDKTSQLE
KTGNDASKAAISRSMTTVWQRWTRLRAVAQDQEKILEDAVEEWKSFNSKVTKASEMIDQL
QAKLPDSSAEKASKAELFALLDHHETLILELEQQHLALGLLRQQALSMLQDGATPSPREE
PSIVQEITAMQDRCLNVQDKVKCNGKAVKQELEERDVVETQINSVKSWIQETKEYLGNPT
IEIEAQLEELQILLTEATNHRQNIEKLTEEQKNKYLGLYSILPSELSLQLAEVALELGTI
HDQIQDKVRDVEQSKAMSQEFGRQIQNIARDLTTILSKLRTKTDNIAQAKTDQKVLGEEL
DGCNLKLVELDAAVQKFSEQNGQLGKPLAKKIGKLIELHQQTLRQAENRLSKLGQAASHL
EEYNEMLEFILKWIEKAKVLLHGKITWNSAHQLREQYILHQSMLEESEEIHSSLEAMIEK
LQHLASVYSTENMSQQVAELGRESEELRQMIRIRMQNLHDAAKDMKKFETELKNLQVALE
QAQTTLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVHAVQICQSALRIPEDVVTNLPLC
HAALHLQEEASRLQHTAIQQCNIMQEAVVQYEQYEQEMQHLQELIEGAHREIEDKPVATS
NIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTE
DLDRELLPATSAHPSVVMMTAGRCHTLLSPVTEESGEEGTSSEISSPPACRSPSPVANTD
ASVNQDIAYYQALSPERLQTDAARIHPSSLPPQEFYEPGLEPSATAKLDDLQRSWETLKN
VISEKQRSLYEALERQQKYQDSLQSISTKMEAIEMKLSESLEPGRSPESQMAEHQALMDE
ILMLQDEISALQSSLAEELVSESPESDPAEQLALQSTLTVLAERMSTIKMKASGKRQLLE
EKLSEQLEEQRQEQALQRYRCEADELDHWLLSTKATLDTALGTATEPMDMETQLVDCQNM
LVEIEQKVVALSELSVHNENLLLEGKAHTKEEAEQLAVKLRTLKGSLLELQRALHDKQLN
IQGTAQEKEESHADLTASQSPGVQDWLAQARTTWAHQRQSSLQQQKELEQELAEQKSLLR
SVASRGEEILTQHSAAETSGGAGEKPDVLSQELGMEGEKSAAEDKMRMKWESLHQEFSTK
QKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDGQTQDRSAVTSLLDGLNQAFEEVSSQG
VGTKRQNIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETEACLFNQETLAKDIKEM
SEEMDKNRNLFSQAFPENGDNRDVIEDTLGCLLGRLSLIDSVVNQRCHQMKERLQQILNF
QNDLKVLCTSLADNKFIILQKLANVFEQPVAEQIEAIQEAEDGLKELDAGIIELKKRGDK
LQIEQPSMQELSKLQDMYDELMMTIGSRRSGLNQNLALKSQYERALQDLADLLETGQEKM
AGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVPQETRFHTELMAQ
ASAVLKQAHKRGVELEYILETWSHLDEAHQELSRQLEAVESSIPSVGLVEESEGRLIERI
TLYQHLKSSLNEYQPKLYQVLDDGKRLLISISCSDLESQLNQLGEHWLNNTNKVSKELHR
LETVLKHWTRYQSESAELTHWLQSAKDRLEFWTQQSVTVPQELEMVRDHLNAFLEFSKEV
DAKSSLKSSVMSTGNQLLRLKKVDTAALRSELSHIESQWTDLLTNIPTVQEKLHQLQMDK
LPSRHAISEVMTWISLMENVIQKDEENIKNSIGYKAIHEYLQKYKGFKIDINCKQLTVDF
VNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQMLEGLLESWSEYEN
DVQSLKAWYETQENRLKQQHRIGDQASVQNAMKDCQDLEDLIKAKEKEVEKIEQNGLALI
QNKKEEVSGVVLNTLRELRQTWANLDRMVGQLKILLKSVFDQWNNHKVAFDEINSYLMEA
KYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQEKNLQRFGSVTNQLFKECHPPVTETL
TNTLKDVNMRWNNLLEEIAEQLHASKALLQLWQRYGDYSKQCASALQQQDDRTNELLKAA
TNKDIADDEVATWIEDCNDLLKELGVVKDSLFVLRELGEQLKQQVDASAASAIQSDQLSL
SQHLCALEQALCKQQTMLQTGVLDYETFTKSLEVLEAWIVEAEEILQGQDPSHSSDLSTI
QERMEELKGQMLKFSSLAPDLDRLNELGYRLPLNDKEIKRMQSLNRHWSLISSQTTERFS
KLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQ
ILHSIIIDGQHLLEQGQVDDRDEFNLKLTLLSSQWQGVIRRAQQRRGIIDSQIRQWQRYR
EMAEKLRKWLVEVSYFPVSALGSVPIPLQQARTLFDEVQFKEKVFLRQQGSYILTVEAGK
QLLLSADSGAEAALQAELSEIQEKWRSASTHLEEQKKKLAFLLKDWEKCENGIANSLEKL
RTFKKKFSQPLPDHHEELHAEQMRCKELENAAGSWTDDLAQLTLLKDTLCAYISADDISI
LNERMELLQRQWEELCHQLSLRRQQVSERLNEWAVFSEKNKELCEWLTQMESKVSQNGDI
LIEEMIEKLKKDYQEEIAVAQENKIQLQQIGERLARASHESKASEIEYKLGKVNDRWQHL
LDLMAARVKKLKETLVAVQQLDKNMSNLRTWLAHIESELAKPIVYDSCDSDEIQKKLTEQ
QELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSME
RRLKIEETWRLWQKFLDDYSRFEDWLKISERTAAFPSSSGVLYTVAKEELKKFEAFQRQV
HESLTQLELINKQYRRLARENRTDSSCSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQ
REEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNHNKIEQIIAQ
GEQLIEKSEPLDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDEHDLSDRELEL
DDSAALSDLHWRDTSVDGVLSPQPSSNPSLSLAQPLRSERSGRDTPASVDSIPLEWDHDY
DLSRDLESAVSRTLPSEDEEGQDDKDFYLRGAVGLSGAPSALESQIRQLDRALDESRFQM
QQTENIIRSKTPTGPELDSTYRGYMKLLSECSGSIDSMRRLEHQLKEEEQNFPGFVNLNT
TETQTAGVIDRWELIQAQALSKELRMKQSLQKWQQFQADLHSVWTWLGEAEQELEQLRRL
ELSTDIQAIELQIKKLKELQKAVDHRKAIILSINLCSSEFTQTGSEKSQDLQDRLCQMNG
RWDRVCSLLEEWRGLLQDALMQCQDFHEMSHGLLLMLENIDRRKNEIVPIDSNLDADTLQ
DHHRQLLQIRHELLESQLRVASLQDMSCQLLVNAEGTDCLEAKEKVHVIGNRLKLLLKEV
SRHIKELEKLLDMSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQRTPRGKCSLSQPG
PSVSSPHSSSRVEGPQWASPQFRTRRLPDGGYPVNPREEPSWERGPPSEIPLLK
Download sequence
Identical sequences M3YGF1
ENSMPUP00000010408 ENSMPUP00000010408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]