SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010415 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010415
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-25
Family Pleckstrin-homology domain (PH domain) 0.052
Further Details:      
 
Domain Number 2 Region: 233-321
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-20
Family Pleckstrin-homology domain (PH domain) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010415   Gene: ENSMPUG00000010492   Transcript: ENSMPUT00000010583
Sequence length 612
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:802510:867025:-1 gene:ENSMPUG00000010492 transcript:ENSMPUT00000010583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWSKLLCVVK
DARLLCYKSSKDQQPQMELPLQGCNITYTPKDSKKKKHELKITQQGTDPLVLAVQSKEQA
EQWLKVIRDVYSGCSGQAESEGPPPSSSPVHKTELEKKLSSERPSSDGEGIMENGVTVCE
GKEQVKRKKSSKSEAKGTVSKVTGKKITKIIGLGKKKPSTDEQTSSAEEDVPTCGYLNVL
SNSRWRERWCRVKDNRLIFHKDRTDLKTHIVSVPLRGCDVIPGLDSKHPLTFRLLRNGQE
VAVLEASSSEDMGRWIGILLAETGSSTDPGTLHYDYIDVETSANVIQTAKQTFCFMNRRG
ISANPYLGSTANGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVMGKGKIPSNQQKKV
DSVAGVKRTSSNADQYKYGKNRVEADAKRLQSKEEELLKRKETLRNRLAQLRKERRDLRA
AIEVNAGRKTQVVLEDKLRRLEEECKQKEAERVNLELELTEVTESLKKALAGGVTLGLAI
EPRSGTSSPQSPVFRHRTLESSPMSSCETSDAEGPMPVNSAAVLRKSQPAGSSPCRGHVL
RKAKEWELKNGT
Download sequence
Identical sequences M3YGF8
ENSMPUP00000010415 ENSMPUP00000010415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]