SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010432 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010432
Domain Number 1 Region: 322-575
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.33e-109
Family STAT DNA-binding domain 0.000000000166
Further Details:      
 
Domain Number 2 Region: 136-321
Classification Level Classification E-value
Superfamily STAT 6.87e-64
Family STAT 0.00000000818
Further Details:      
 
Domain Number 3 Region: 576-714
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-43
Family SH2 domain 0.0000000921
Further Details:      
 
Domain Number 4 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 7.72e-42
Family Transcription factor STAT-4 N-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010432   Gene: ENSMPUG00000010509   Transcript: ENSMPUT00000010600
Sequence length 770
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:3606716:3679936:1 gene:ENSMPUG00000010509 transcript:ENSMPUT00000010600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAAWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRNIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Download sequence
Identical sequences M3YGH5
ENSMPUP00000010432 ENSMPUP00000010432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]