SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010434 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010434
Domain Number 1 Region: 558-719
Classification Level Classification E-value
Superfamily TPR-like 0.0000000101
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 767-932
Classification Level Classification E-value
Superfamily TPR-like 0.0000000737
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 3 Region: 1125-1245
Classification Level Classification E-value
Superfamily TPR-like 0.0000000759
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 
Domain Number 4 Region: 307-364
Classification Level Classification E-value
Superfamily SH3-domain 0.00000476
Family SH3-domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010434
Domain Number - Region: 1245-1312
Classification Level Classification E-value
Superfamily TPR-like 0.000104
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010434   Gene: ENSMPUG00000010511   Transcript: ENSMPUT00000010602
Sequence length 1335
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:1105104:1153311:1 gene:ENSMPUG00000010511 transcript:ENSMPUT00000010602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPVEEPAPEGRGPTAAPSGGSGGGGHKVPRVAMSASVVWERAGPKEAKAMVGGDATPP
PGGSGLASGTPPVQMGTYPTDLTLQLLAVRRKTGLLDPSLQQTVRSRLRLLENDSREVAR
ALGELSARLLSIHSDQARIVVTFKTFEEIWKFSTYHALGFTHHCLENLLVDQVFWLLSPS
EDEETAVHVHVDQEALTRTHESLLAQEGPFFVLCPDHRVRVKTSPQGAGSGPQALRRGSR
VLQGEAAPAVDPSAPGSSMSSEDMAAAAAPETLIPFHQWALRVPWDPIDDSVSGPVTSDI
SLMATGLATAVADDQGSGPEEMTFCSGDVIEVLGAQVPGLPWCLGRHTASGQVGFVRTSL
ISVQGQVSDLENVIFLNEEEKSFFSSEGRFSEEDARQLLRRVSGMDVCTVYSLDRLEEAE
FEQLGDQEMPLPGLHPDPCETLQKVKNVLEQCKSGQGCPEEPVSWGLCMASSGTGSPHSE
EPSFCLDSGADWAHPEVLGSLLLFLDVPGYEACFRGLYDLSLPGLSTLFPGFTDEEELAE
HLAQARGAAKKAGFPMALARLCFLLGRLCVRRLKLSQARVYFEEALGALGGHFGDLFLVV
AVYANLATVHLKQKNRDRCAQVVPKALALLLGTPSHLCSSEAESPLLRLALRRAILCHSP
QAEARACFLLAKHHTRLKQLEEALPFLERLLLLHGAMGTPEATWPVDCYLLLADIYSRQC
LPHLALGCVRGASLQARGSPGSALRSVDLVLRNSPRLHRPPAQTALYLRQALASVAPNPS
WALRGLLCASLAQLHSRHGQQDTAISFMMQAVDVAMGAGSHLAVDYIVALAWLYVLCGQS
MVALDILESVLDMAVASVDQEGVIANMVAVALRRTGRIRQAAEGYYRALRVARAQGQLQN
QAVVLANFGALCLQAGAESLAQHYHRESVTLFARLPSRECGPDLTWVLLRLGHLYTRRAL
ARQAKCCYEWAFLVAVETDHVEGQLRAVQRLCHFYRTVMPREAQCVVYHEFQLSLARRVA
DKVLEGQLLETISQLYLSLGTERAYKSALDYTKRSLGIFIDLQRKEKEAHAWLQAGKIYY
ILQQNELVDLYIQVAQNAALYTGDPNLGLELFEAAGDIFFNGTWEREKAVSFYRDRALPL
AVTTGNQEAELRLCNKLVALLAELELPHEGLEFAHMALALSITRGDRLNERVAYHRLAVL
HQRLGHGELAEHFYLKALSLCGSPLQFDEETLYYVKVYLVLGDILFYDLKDPFDAAGYYQ
LALAAAVDLGNKKAQMKIYTRLAIIYHNFLLDREKSLFFYQKARTFATELNVRRVNLAPA
RCWGRAPWLVAGPPP
Download sequence
Identical sequences M3YGH7
XP_004772274.1.14098 XP_004772275.1.14098 XP_012901286.1.14098 ENSMPUP00000010434 ENSMPUP00000010434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]