SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010440 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010440
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.49e-97
Family STAT DNA-binding domain 0.0000637
Further Details:      
 
Domain Number 2 Region: 136-332
Classification Level Classification E-value
Superfamily STAT 2.16e-54
Family STAT 0.00019
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.05e-39
Family Transcription factor STAT-4 N-domain 0.00036
Further Details:      
 
Domain Number 4 Region: 587-702
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-34
Family SH2 domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010440   Gene: ENSMPUG00000010517   Transcript: ENSMPUT00000010608
Sequence length 794
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:3680724:3702305:-1 gene:ENSMPUG00000010517 transcript:ENSMPUT00000010608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDALDPENPQDQAQASQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGNSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAGLAQLSPQERLSRETALQQKQVSLEAWLQHEAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLLGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADSAGGSATY
MDQAPSPAVCPPAHYNMYPQNPDAVLDQDGEFDLDETMDVARHVEELLRRRMDGLDPRLS
PPAGLFTSARGSLS
Download sequence
Identical sequences M3YGI3
ENSMPUP00000010440 XP_004772751.1.14098 ENSMPUP00000010440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]