SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010442 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010442
Domain Number 1 Region: 172-379
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.16e-54
Family Prokaryotic proteases 0.000000447
Further Details:      
 
Domain Number 2 Region: 56-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.0032
Further Details:      
 
Domain Number 3 Region: 112-160
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000398
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010442
Domain Number - Region: 387-430
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00192
Family HtrA-like serine proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010442   Gene: ENSMPUG00000010519   Transcript: ENSMPUT00000010610
Sequence length 431
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:1177300:1204405:1 gene:ENSMPUG00000010519 transcript:ENSMPUT00000010610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPRARPCPLRKRLSPGPDRSPVLPPAPGAAAMPARALLLTALAALALAREPPAAPCPAR
CDVSRCPSPRCPGGYVPDLCNCCLVCAASEGEPCGRPLDSPCGESLECTRGVCRCRWAHA
VCGTDGHTYANVCALQAASRRALELSGTPVRQLQKGACPSGLHQLTSPRYKFNFIADVVE
KIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIVTNAHVVSSTNTVSGRQQLKVQ
LQNGDSYEATIKDIDKKSDIATIKIHPKKKLPALLLGRSADLRPGEFVVAIGSPFALQNT
VTTGIVSTAQRDGKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGI
SFAIPSDRITRFLAEFQDKHVKDWKKRFIGIRMRTITSNLVEELKASNPDFPSVSSGIYV
QEVVPNSPSQR
Download sequence
Identical sequences M3YGI5
ENSMPUP00000010442 ENSMPUP00000010442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]