SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010444 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010444
Domain Number 1 Region: 646-890
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 529-606
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-25
Family Nuclear receptor 0.0000166
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010444
Domain Number - Region: 360-393
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0225
Family Formin homology 2 domain (FH2 domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010444   Gene: ENSMPUG00000010521   Transcript: ENSMPUT00000010612
Sequence length 892
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897250.1:74448:274967:-1 gene:ENSMPUG00000010521 transcript:ENSMPUT00000010612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGARLQQQQQQ
QQQQQQETSSRQQQQQQQQQGDDGSPQAQRRGPTGYLALDEEQQPSQQQSAHKGHPESGC
VPEPGAASATGKGLQQQQPAPPDEDDSAAPSTLSLLGPTFPGLSSCSTDLKDILSEAGTM
QLLQQQQEVVSEGSSSGRAREAAGAPTSSKDSYLGGSSTISDSAKELCKAVSVSMGLGVE
TLEHLSPGEQLRGDCMYAPILGGPPAVRPCAPLAECKGSLLDDGGSKGTEETAEYSPFKA
GYAKGLDGDSLGCSGTSEAGGSGTLELPSTLSLYKSGALDEAAAYQNRDYYNFPLALAGP
PPPPPPPHPHARIKLESPLDYGSAWAAAAAQCRYGDLSSLHGGGAAGPSSGSPSTTASSS
WHTLFTAEEGQLYGPCGGSGGGSAGEAGSVAPYGYTRPPQGLAGQEGDFPPPDVWYPGGV
VSRVPYPSPSCVKSEMSPWIESYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEAS
GCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLG
ARKLKKLGNLKLQEEGEASSATSPTEEPTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCA
GHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVF
AMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCM
KALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQ
PIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences M3YGI7
ENSMPUP00000010444 XP_004780480.1.14098 ENSMPUP00000010444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]