SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010466 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010466
Domain Number 1 Region: 56-96
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000262
Family C-type lectin domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010466
Domain Number - Region: 13-69
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0323
Family p53 DNA-binding domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010466   Gene: ENSMPUG00000010544   Transcript: ENSMPUT00000010635
Sequence length 96
Comment pep:novel scaffold:MusPutFur1.0:GL897376.1:82315:84280:1 gene:ENSMPUG00000010544 transcript:ENSMPUT00000010635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGIHNHNFIIWTEVFQKCPAHTMQNKNDTKEKNASLGEVEDDSILPPIIDEDYESFQGN
WHCCGKSCYYFSEEEKSWEESKKSCEVLSSRLMKID
Download sequence
Identical sequences M3YGK9
ENSMPUP00000010466 ENSMPUP00000010466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]