SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010479 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010479
Domain Number 1 Region: 182-507
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.86e-76
Family Pancreatic carboxypeptidases 0.00000249
Further Details:      
 
Domain Number 2 Region: 44-164
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.1e-30
Family Frizzled cysteine-rich domain 0.00068
Further Details:      
 
Domain Number 3 Region: 507-587
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.94e-18
Family Carboxypeptidase regulatory domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010479   Gene: ENSMPUG00000010557   Transcript: ENSMPUT00000010648
Sequence length 658
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:1362114:1384168:1 gene:ENSMPUG00000010557 transcript:ENSMPUT00000010648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPPPLLLLLLAALAAAARPRCPLARGTTGDCHGPWAADSATCVDMPLRTCSDVAYNQ
TAFPTLLEHRSREAVEASSEYILLSVLHHLLEGQCNPDLRLLGCAVLAPRCEGGRVRRPC
RHVCEGLREACQPAFDAIDMAWPYFLDCSRYFASVEEGCYDPLEKLREGLDVEEALPSGL
PPTFLHFTHHSYAQMVRVLRRTAARCAHIAKTYSIGRSFNGKELLVIEFSARPGQHELME
PEVKLIGNIHGNEVAGREMLIYLAQYLCTEYLLGSARIQRLLNTTRIHLLPSMNPDGYEV
AAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAESRSVRSDHIPIPQHYWWGKVA
PETKAIMKWMRTTPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLARAY
ADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHSNCFEITVELGCVKF
PPEEALYTLWQHNKEPLLNFMETVHRGIKGVVMDKFGKPVKNARIVVKGIRHDITTAPDG
DYWRLLPPGSHIVIAQAPGYSKVIKKVTIPARMKRAGRVDFILQPLGTRPKQLLLGPRRS
GSGLRDPPGGASRYGEPEEPGQEPLGGRRQPSVGGSKPWWWSYFTSLSEHKPRWLLKY
Download sequence
Identical sequences M3YGM2
XP_004772287.1.14098 ENSMPUP00000010479 ENSMPUP00000010479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]