SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010498 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010498
Domain Number 1 Region: 102-220
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-28
Family Phosphotyrosine-binding domain (PTB) 0.033
Further Details:      
 
Domain Number 2 Region: 8-118
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000263
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010498   Gene: ENSMPUG00000010576   Transcript: ENSMPUT00000010667
Sequence length 595
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:1880005:1906691:-1 gene:ENSMPUG00000010576 transcript:ENSMPUT00000010667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEAALVEGQVKLRDGKKWKTRWLVLRKPSPVADCLLMLVYKDKAERAKGLRERSSLTLE
DICGLEPGLPYEGLAHTLAILCLSQAVMLGFESREAMCAWDTRIRYALGEVHRFHVAVAP
GTKLESGPATLHLCNDVLVLARDVPPAVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAG
VFFLSSAEGEQISFLFDCIVRGISPTKGPFGLRPVLPDPSPGGPATAEERVAQEALEALK
LEKRLSLLSHGVRPGSGGDDRSLSSSSSEASHSDISAGSRLTAWPEPSLSSASTSQEGPG
LAAAQVSGEAAPGISRQPPKPLRPRQLQEVGRQSSSDSGIATGSHSSYSGSFSSCAGSSL
DVWRTGDEFGSLLSLPPVAGVPEPSLCACPPGTAEYQVPTAQRHHYDTPRSLRQAPRDQS
PAAQGGPDDPGAGDSGGQMSTGCPSGWLGTRRRGQATEAPGCEAPGEGWEAGSPHAGHPP
AFFSTCPVCGGLKGAVASPPRLLMMHSGAPGSERPSSEAPPYVNVPVSPSPKAQLQYLGL
ELQGASAGIRGAGASRYAQIDIVATEAAHRAGAQHAQTREERLPELDQRRKGTPR
Download sequence
Identical sequences M3YGP1
ENSMPUP00000010498 XP_004772291.2.14098 ENSMPUP00000010498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]