SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010515 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010515
Domain Number 1 Region: 97-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010515   Gene: ENSMPUG00000010593   Transcript: ENSMPUT00000010684
Sequence length 198
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896985.1:5963227:5967441:1 gene:ENSMPUG00000010593 transcript:ENSMPUT00000010684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSVSDPEEMELRGLQRGYPVPASKRPSLRGAEGSYISPSDNSSAEEEDPDGEEERCV
LGAAGGAEGCKRKRPRVAGGGGGKKPLPPKGSAADCKQSQRNAANARERARMRVLSKAFS
RLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRP
DSDTKEVSAANRLCGTTA
Download sequence
Identical sequences M3YGQ8
ENSMPUP00000010515 XP_004762422.1.14098 ENSMPUP00000010515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]