SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010530 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010530
Domain Number 1 Region: 281-482
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-50
Family DBL homology domain (DH-domain) 0.00000000554
Further Details:      
 
Domain Number 2 Region: 474-598
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-35
Family Pleckstrin-homology domain (PH domain) 0.0000157
Further Details:      
 
Domain Number 3 Region: 206-275
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-25
Family SH3-domain 0.0000482
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010530
Domain Number - Region: 125-166
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00667
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 
Domain Number - Region: 780-836
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.00732
Family Oxygen-evolving enhancer protein 3, 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010530   Gene: ENSMPUG00000010609   Transcript: ENSMPUT00000010700
Sequence length 844
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896915.1:1942125:2036293:-1 gene:ENSMPUG00000010609 transcript:ENSMPUT00000010700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPRPLPGIPASPVRLASPDRGALLGPGSPAPPRELRVTGRGLRSGPAASPRPASGASA
LARLRPAAGEEPAAASAPCPAAESAEVSVRRGQAPAGLLEEKPEAPEPATDRCSERGPRT
PARQQTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGTQ
PSHSRTSKLFQGQYRSLDMTDNSNSQLVVRAKFNFQQTNEDELSFAKGDVIHVTRVEEGG
WWEGMHNGRTGWFPSNYVREVKPSEKPVSPKSGALKSPPKGFDTTAINKSYYNVVLQNIL
ETENEYSKELQTVLSAYLRPLQTSEKLSSANTSHLMGNLEEICSFQQMLVQSLEECTKLP
EAQQRVGGCFLNLMPQMKTLYLAYCANHPSAVNVLTEHSEQLGEFMESRGASSPGILVLT
TGLSRPFLRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKTLSAQCQEVRKRKELELQ
ILTEAIRSWEGDDITTLGSVVYMSQVMVQCAGSEEKNERYLLLFPNILLMLSASPRMSGF
IYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCSNQQDLHEWVDHLQKQTKVT
SVGNPTIKPHSVPSHTLPSHPMAPSSKHADSKPVPLTPAYHTLPHPSHHGTPHTTINWGP
LEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFAL
RKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESAPQVLLPEEEKMIVEETKSNGQ
TVIEEKSLVDTVYALRDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWD
ETNL
Download sequence
Identical sequences M3YGS3
ENSMPUP00000010530 XP_012908517.1.14098 ENSMPUP00000010530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]