SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010567 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010567
Domain Number 1 Region: 354-472
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.18e-31
Family PLC-like (P variant) 0.00000225
Further Details:      
 
Domain Number 2 Region: 36-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.5e-29
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 
Domain Number 3 Region: 198-316
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.59e-20
Family PLC-like (P variant) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010567   Gene: ENSMPUG00000010646   Transcript: ENSMPUT00000010737
Sequence length 724
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896971.1:32107:196385:1 gene:ENSMPUG00000010646 transcript:ENSMPUT00000010737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKLCESGDLNASLTSQQFEEPSMFGEAGDGLSNLPSPFAYLLTIHLKEGRNLVIRDRCGT
SDPYVKFKLNGKTLYKSKVIYKNLNPVWDEIVVLPIQSLDQKLRVKVYDRDLTTSDFMGS
AFVVLRDLELNRTTEHILKLEDPNSLEEDMGVIVLNLSLVVKQGDFKRHRWSSRKRLSAS
KSSLIRNLRLSESLRKNQLWNGIISITLLEGKDVAGGSMTEMFVQLKLGDQRYKSKTLCK
SANPQWREQFDFHYFSDRMGILDIEVWGKDSRKHEERLGTCKVDISALPLKQANCLELPL
ESCLGALLMLITLTPCAGVSVSDLCVCPLADPGERKQIAQRYCFQNSLKDMKDVGILQVK
VLKAVDLLAADFSGKSDPFCLLELGNDRLQTHTIYKNLNPEWNKVFTFPIKDIHDVLEVT
VFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGAIYLEMDLIYNPVKAS
IRTFTPKEKRFVEDTRKLSKKILSRDIDRVKRITMAMWNTIQFLKSCFQWESTGRSAVAF
VVFLVTVWNFELYMIPLALLLLFIYNFITPTKGKVGSIQDSQESTDLEEEEDEEDKESEK
KGLIERIYMVQDIVSTVQNILEEIASFGERIKNTFNWTVPFLSFLACLILAVATIILYFI
PLRYIVLIWGINKFTKKLRNPYAIDNNELLDFLSRVPSDVQKVQYAELKPCSSQSPLRKK
RSAL
Download sequence
Identical sequences M3YGW0
ENSMPUP00000010567 ENSMPUP00000010567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]