SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010611 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010611
Domain Number 1 Region: 25-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2178-2297
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-38
Family Pleckstrin-homology domain (PH domain) 0.00000198
Further Details:      
 
Domain Number 3 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 998-1153
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 5 Region: 626-730
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-28
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 6 Region: 1210-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-28
Family Spectrin repeat 0.00044
Further Details:      
 
Domain Number 7 Region: 1846-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 895-1045
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-27
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 9 Region: 798-938
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 10 Region: 1440-1577
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-24
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 11 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-24
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1686-1791
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 13 Region: 1582-1683
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 14 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 15 Region: 1371-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-18
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 16 Region: 2005-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000317
Family Spectrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010611
Domain Number - Region: 1156-1229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0122
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010611   Gene: ENSMPUG00000010694   Transcript: ENSMPUT00000010785
Sequence length 2351
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897117.1:728903:841323:-1 gene:ENSMPUG00000010694 transcript:ENSMPUT00000010785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQRTSSISGPLSPAYTGQVPYNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENY
HDIKRITARKDNVIRLWEYLLELLKARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLS
QDYGKHLLGVEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRV
AHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSV
MRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIQYIREQWANLEQLS
AIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEI
ANYRPTIDTLHEQAGALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYK
MFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIRE
KTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAI
LSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNT
LTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNE
LHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQED
FMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKD
NRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKI
EKEGMQLISEKPETEAVVKEKLTGLHNMWEVLESTTQTKAQRLFDANKAELFTQSCADLD
KWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKST
DEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDH
GHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLNAEAIRRRLADLKEL
WGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKK
HQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGK
LDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQE
RVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHD
AKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAA
YAGDKADDIQKRENEVLEAWKALLDACDGRRARLVDTGDKFRFFSMVRDLMLWMEDVIRQ
IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLL
QLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVE
KLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKASEET
ESQQQWDTSKGEQVSQNGLPAEQGSPRMAETGDTSEMVNGAAEQRTSSKESSPIPSPTSD
RKAKSALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQE
MGFYKDAKTAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLNDGNEYLFQAKDDE
EMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDK
EKRFSIFGKKK
Download sequence
Identical sequences M3YH04
ENSMPUP00000010611 XP_004775736.1.14098 ENSMPUP00000010611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]