SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010628 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010628
Domain Number 1 Region: 13-159,197-250
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-43
Family Ras GEF 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010628   Gene: ENSMPUG00000010712   Transcript: ENSMPUT00000010803
Sequence length 251
Comment pep:novel scaffold:MusPutFur1.0:GL897003.1:194797:200402:-1 gene:ENSMPUG00000010712 transcript:ENSMPUT00000010803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPTATPEASSQHKNELKEKKADLLDFPPKLVGEQLTYMDAELFKKVVLHQCLGSIWSQRN
RPGNEHLAPTVRAAIAQFNAVASCIVPTCFGNPSMTARDRAVVVDHYFIQGGAVCQILGN
YSSLHAILVALQSVSIHCLKRTWDNVSRKNFQTFKNLCREDNPPGRELPIKLSQFYKSLQ
RRQPPGQKVQKRLPKKGVVPYIVTFLIDLVMLETAKGNEINHSKNNKDQEYRVLTDIMLL
QAAAGNYCLEP
Download sequence
Identical sequences M3YH21
ENSMPUP00000010628 ENSMPUP00000010628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]