SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010648 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010648
Domain Number 1 Region: 21-197
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 1.16e-42
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010648   Gene: ENSMPUG00000010734   Transcript: ENSMPUT00000010825
Sequence length 225
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896971.1:3951777:3954677:1 gene:ENSMPUG00000010734 transcript:ENSMPUT00000010825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPLMVVAYLSECPGMPQAVNAWLRVQELSKLGLNSDKNIELRILQLPVDYREVKQKVTRI
WEDLKPQFVVHIGMDTSAKAIILEQCAKNRSYQDADIRGFRPACGECLPDGPEVIASEVS
MKAVRKRIAVEGVEVIFSRDAGRYVCDYTYYLSLHHGNGYAALIHVPRLSLWFPARLLGK
ALQVIIQDMLEELRKPELEASFAENSTVAIPAQGNQLGDCSFREN
Download sequence
Identical sequences M3YH41
ENSMPUP00000010648 ENSMPUP00000010648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]