SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010667 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010667
Domain Number 1 Region: 2689-2857
Classification Level Classification E-value
Superfamily Cyclophilin-like 8.18e-67
Family Cyclophilin (peptidylprolyl isomerase) 0.000000769
Further Details:      
 
Domain Number 2 Region: 1951-2081
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-45
Family Ran-binding domain 0.0000443
Further Details:      
 
Domain Number 3 Region: 2540-2679
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-44
Family Ran-binding domain 0.0000284
Further Details:      
 
Domain Number 4 Region: 1653-1784
Classification Level Classification E-value
Superfamily PH domain-like 7.84e-44
Family Ran-binding domain 0.00000107
Further Details:      
 
Domain Number 5 Region: 1167-1217
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000012
Family Ran-binding domain 0.00025
Further Details:      
 
Domain Number 6 Region: 31-191
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000175
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 7 Region: 1420-1448
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000251
Family Ran binding protein zinc finger-like 0.0015
Further Details:      
 
Domain Number 8 Region: 1361-1387
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000373
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Domain Number 9 Region: 1302-1328
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000746
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Domain Number 10 Region: 1239-1265
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000647
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010667   Gene: ENSMPUG00000010754   Transcript: ENSMPUT00000010845
Sequence length 2857
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897003.1:1416086:1500793:-1 gene:ENSMPUG00000010754 transcript:ENSMPUT00000010845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSKADVERYIASVQGSVPSPREKSMKGFYFAKLYYEVKEYDLAKKYITAYINVQERDP
KAHRFLGLLHEVEENIDKAVECYKRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVER
AAKLFPGSPAIYKLKEQLLDCKGEDGWNKLFDLIQSELYARPDDVYVNIRLVELYRSNKR
LKDAVGHCHEAEKNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSNWQTTNKDLLLAYA
NLMHLTLSTRDVQESRELLESFDSALQSVKSCVGGNDELSTTFLEVKGHFYMHAGSLLLK
MGQHSEVQWRAVSELATLCYLIAFQVPRPKIKLIKGEVGQNLVEMMACDRLSQSGHMLLN
LSRDKQDFLKEVVESFANKSGQSALYDALFSSQSPKDRSFLGNDDIGNIDVQVPEPDDLA
RYDVGAIRAHNGSLQHLTWLGLQWNSLSALPAVRKWLKQLFHHLPQETSRLETNAPESIC
ILDLEVFLLGVIYTSHLQLKEKCSSHCSFYQPLCLPLPVCKQLCTERQKSWWDAVCNLIH
RKTIPGTTAKLRLLVQHDINTLRGQEKHGLQPALLVHWAKCLQKTGSGLNSFYDQREYIG
RSVHYWKKVLPMLKTIKKKSSIPEPTDPLFKHFHSADIQASEVGEYEEEAHITFAILDVV
NGNIEDAMTAFESIKNVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKARDYLIK
ILDDSDSNLSVAKKLPVPLESVKEMLNSVMQELDDYSEGGPFYKNGSLRNADSEIKHSTP
SPSIYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLHSSNSGSPHR
WPPENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYSQQMHTPPVQSSSACMFSQEMYGPPLRFESPATGILSPRGDDY
FNYNVQQTSTNPPLPEPGYFTKPPVAAHASRPAESKVIEFGKSNFVQPVPGEGIRPSLTA
PAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVTQPPSTAYNNNESLLGLLTSDKPLQGDGY
SGPKASQTIGPRNTFSFGSKNVPGISFTENMGPNQQKNSGFRRSDDMFTFHGPGKSVFGT
PAPELANKSHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFRF
DAESKEWKERGIAPASFKFGTSEISKTPKSGFEDMFAKKEGQWDCSCCSLRNEASATVCV
ACRNPGKLSLSTSVPAPASFKFSTSETSKAPKSGFEGMFTKKEGQWDCSICLVRNEASAT
TCVACQNPSKQNQPTSAVLAPASSDTCKAPKSGFEGMFTKKEGQWDCSICLVRNEASATT
CVACQNPSKQNQPTSAVLAPASSDTCKPPKGGFEGMFTKKEGQWDCSICFVQNESSSLKC
VACDASKPTHKPIAEAPSAFTLGSKTKLNDSSGNQVGTGFKSNFSEKGFKFGTAEQGFKF
GHVDQESTPSFTFQGSSNTDSKSTKEGFSFSVPMSADGFKFGIQESGIQEKKSEKPLENE
PGVQAQDISSQKNGSSVIFGQTGSTFTFADLAKSTSGEGFQFGKKDPNFKGFSGAGEKLF
SSQSGKMADKADTSADLEKDDDAYRTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQR
VKLFRFDAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLS
GSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVD
TGRAAKLIQRAEEMKSGLKDFKTFLTNDQTKVTDGESESSDAGAASASDTTSKPNPENTG
PTLEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSK
SPAKLNQSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKL
YRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQNMKGTE
RVWVWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKIAQEKDSLITPQVSRSTTP
RESPCGKIAVAVLEETTRERTDLIQSDDTADATSEVGEASSTSEATTKAVVSPPKFVFGS
ESVKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKNSSEISSVVKSGSERKVEPNCKES
KNSDGKQSSDGKVRNLFAFPKEESSTNYTFKTPEKAKEKVKPEDPPSDDDVLIVYELIPT
PEQKDLASKLKLPPTFFCYKNKPDYISEEEEDDEDFETAVKKLNGKLYLDDSEKCRPLEE
KLTDNEKECVIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSEFQKVQ
DSQKSQSEEIANMADSMYTRGSKVTAPFLCKSEEPGFITKSASSPPVSSGTVDKPVDLSA
RKENDADSISQVESKTVSFGFGSSAGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFG
AQSTSKVGEDEDGSDEEVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKERAKLYRWDREV
SQWKERGIGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSNNALVWTA
SDYADGEAKVEQLAVRFKTKEMADCFKKKFEECQQNLLKLQKGQVSLTAELSKETNPVVF
FDVCADDEPLGRITMELFSNIVPQTAENFRALCTGEKGFGFKNSIFHRVIPDFVCQGGDI
TKHDGTGGRSIYGDKFEDENFDVKHTGPGLLSMANRGRDTNNSQFFITLKKAEHLDFKHV
VFGFVKDGMDTVKKIESFGSPKGSVSRRISITECGQI
Download sequence
Identical sequences M3YH60
ENSMPUP00000010667 ENSMPUP00000010667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]