SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010694 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010694
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-24
Family PDZ domain 0.0019
Further Details:      
 
Domain Number 2 Region: 182-264
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000697
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000965
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010694   Gene: ENSMPUG00000010782   Transcript: ENSMPUT00000010873
Sequence length 517
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897118.1:127792:510561:-1 gene:ENSMPUG00000010782 transcript:ENSMPUT00000010873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVISKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRSPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
SGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKHCFTV
QSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAILWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGNQATASAAASSATTSKTKYTT
Download sequence
Identical sequences M3YH87
XP_012902859.1.14098 ENSMPUP00000010694 ENSMPUP00000010694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]