SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010715 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010715
Domain Number 1 Region: 143-721
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.26e-183
Family Lysophospholipase 7.59e-16
Further Details:      
 
Domain Number 2 Region: 16-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-24
Family PLC-like (P variant) 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010715   Gene: ENSMPUG00000010803   Transcript: ENSMPUT00000010894
Sequence length 749
Comment pep:known scaffold:MusPutFur1.0:GL897300.1:339247:514175:1 gene:ENSMPUG00000010803 transcript:ENSMPUT00000010894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEVTLMDANYVMDETLGTATFPISSMKVGEKKEV
PFIFNQVTEMFLEMSLEVCSSPDLRFSMALCDQEKTFRQQRKENIKENMKKLLGPENSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVIKALYEAGILDCATYIAGLSGSTWYMSTLYSH
PDFPQKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNSGQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQNKGSTMEEE
LENITAEHIVSNDSSDSDDESQEPKGTENEDAKREYHNDNQASWVHRMIMALVSDSTLFN
TREGRAGKVHNFMLGLNLNTSYPMSPLKDFMTQESLDEDELDTAVADPDEFEQIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWSRMN
KLPFPKIDPQVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNEAFKRLHDLMHFNTLNNIDVIKNAIVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPAA
Download sequence
Identical sequences G9KGY2
ENSMPUP00000010715 ENSMPUP00000010715 XP_004781614.1.14098 XP_004781615.1.14098 XP_012905965.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]