SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010802 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010802
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.0000000212
Family Myeloperoxidase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010802   Gene: ENSMPUG00000010889   Transcript: ENSMPUT00000010981
Sequence length 133
Comment pep:novel scaffold:MusPutFur1.0:GL896926.1:11314029:11315461:-1 gene:ENSMPUG00000010889 transcript:ENSMPUT00000010981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAAGQPSRRNRTVLGVFFGYHVLSDLVSVETPGCPAEFLNIHIPPGDPVFDPDRRGDV
VLPFQRSRWDPETGRSPSNPRDLVRLGGRGPEVAARQGGAGLPPPRPPTPASAPPPPAHP
GGSPSSCPCRATR
Download sequence
Identical sequences M3YHJ5
ENSMPUP00000010802 ENSMPUP00000010802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]