SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010817 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010817
Domain Number 1 Region: 138-258
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-23
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 2 Region: 13-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.31e-21
Family Synaptotagmin-like (S variant) 0.04
Further Details:      
 
Domain Number 3 Region: 287-490
Classification Level Classification E-value
Superfamily vWA-like 2.67e-19
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010817   Gene: ENSMPUG00000010903   Transcript: ENSMPUT00000010996
Sequence length 533
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897024.1:2693662:2743425:1 gene:ENSMPUG00000010903 transcript:ENSMPUT00000010996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQCVTKVELNVSCDNLLDMDVGSKSDPLCVLFLNTSGQQWYEVDRTERIKNCLNPTFS
KTFVIDYYFEVVQKLKFGIYDIDNKTIQLNDDDFLGEFECTLGQIVSSKKLTRPLVLKNG
RPAGKGSITISAEEIKDNRVVLFEIEARKLDNKDLFGKSDPYLEFHKQTSDGNWLMVHRT
EVIKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFHTTMTKLKEAS
RNSPVEFECINEKKRQKKKSYKNSGVISVKQCEMTVECTFLDYIMGGCQLNFTVGVDFTG
SNGDPRSPDSLHYISPNGVNEYLTAIWSVGLVIQDYDTDKMFPAFGFGAQIPPQWQVSHE
FPMNFNPSNPYCNGIQGIVEAYRACLPQIKLYGPTNFSPIINHVARFAAAATQQQTASQY
YVLLIITDGVITDLDETRQAIVNAAKLPMSIIIVGVGGADFSAMEFLDGDGGSLRSPSGE
VAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPAKK
Download sequence
Identical sequences M3YHL0
ENSMPUP00000010817 ENSMPUP00000010817 XP_004767026.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]