SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010826 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010826
Domain Number 1 Region: 350-428
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.74e-26
Family Intermediate filament protein, coiled coil region 0.00083
Further Details:      
 
Domain Number 2 Region: 120-154
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000994
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010826
Domain Number - Region: 232-346
Classification Level Classification E-value
Superfamily Prefoldin 0.000628
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010826   Gene: ENSMPUG00000010912   Transcript: ENSMPUT00000011005
Sequence length 481
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:4222817:4226040:1 gene:ENSMPUG00000010912 transcript:ENSMPUT00000011005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTCSRQFTSSSSMKGSCGIGGGSSRMSSVLAGGSCRAPSAYGGLSVSSSRYSSGGACGL
GGGYGGGFSSSSSFGGGLGSGFGGGYGGGLGAGFGGGLGAGFGAGFGGGFGGGDGGLLSG
NEKVTMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQRQRPSEAKDYSPYFKTIEDLR
NKIIAATIENAQPILQIDNARLAADDFRTKYEHELTLRQSVEADINGLRRVLDELTLART
DLEMQIEGLKEELAYLKKNHEEEMLALRGQTGGDVSVEMDAAPGVDLSRILNEMRDQYEQ
MAEKNRRDAEAWFLSKTEELNKEVASNSELVQSGRSEVTELRRVLQGLEIELQSQLSMKA
SLEGSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQVLLDVKTRLEQEIA
TYRRLLEGEDAHLSSQQGSSHSYSSHNVFSSSSSSSSGHQTRPILKEQGSSSFNQGQGSK
H
Download sequence
Identical sequences M3YHL9
ENSMPUP00000010826 ENSMPUP00000010826 XP_004772800.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]