SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010854 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010854
Domain Number 1 Region: 23-129
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-22
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 481-554
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000687
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010854   Gene: ENSMPUG00000010942   Transcript: ENSMPUT00000011035
Sequence length 592
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:2434160:2475722:-1 gene:ENSMPUG00000010942 transcript:ENSMPUT00000011035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCIYY
FKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIVHISKKHRTWFFSASSEDERKS
WMALLRKEIGHFHEKKELPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHEDED
DSYMEPDSPKPMEPEDTLTHPPAYPPPPVPTPRKPAFSDMPRAHSFASKGLSPLLPPPPP
KRGLPDASPAPEDSKRDPLGLRRPEPGPRGSLAPRRMSDPPLGPPPTTPSLWKTPCFRES
ASPSPEPRVPSHGPGSACSSAGMAAASSRNCDKLKSFHLSPRGPPTPEPPPVPANKPKFL
KMVEEAPVGEAARPRLFVPPVAPRPPALKLSTPEATARPVVLPRTEKPPLPHLQRSPPDG
QSFRNFSFEKPRRLSKADSTGGEDSDEDYEKVPLPSSVFINTTESCEVERLFKTTSPQGE
PQNGLYCIRNSSTKSGKVLVVWDESSNKVRNYRIFEKDSKFYLESEVLFVSVGGLVEHYH
THVLPGHQSLLLQRPYGYMRPSKIHIQKNEQNTNVQPRKLLRGKHTYDPIRR
Download sequence
Identical sequences M3YHP7
ENSMPUP00000010854 ENSMPUP00000010854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]