SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010871 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010871
Domain Number 1 Region: 12-296
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-63
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 435-518
Classification Level Classification E-value
Superfamily DEATH domain 2.87e-17
Family Caspase recruitment domain, CARD 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010871   Gene: ENSMPUG00000010960   Transcript: ENSMPUT00000011053
Sequence length 538
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897024.1:5429652:5458891:1 gene:ENSMPUG00000010960 transcript:ENSMPUT00000011053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNREGICSALPTIPCHKLADLRYLSRGASGTVSSARHADWRVQVAVKQLHIHTPLLDSER
NDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRT
SKSSPEGGTIIYMPPENYEPGQKSRASIKHDIYSFAVIMWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPNTNEESLPLDIPHRTLMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
AFLEAVIQLKKTKLQSTLSTIHLCDMKKMDSSLNTPITHGPQEESCGSSQLHESSDSAIA
SKSLTAPQENDFLSRKTQDFSTLCHYPVNHSCNSNISAVQKRTFCDHKTTPGSSAVITPL
SAEGNSERLQPGIAQQWIQSKREDIVSQMTEACLNQSLDALLSRDLLMKEDYELISTKPT
RTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSQSLYLFQNKSS
Download sequence
Identical sequences M3YHR4
ENSMPUP00000010871 ENSMPUP00000010871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]