SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010900 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010900
Domain Number 1 Region: 5-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010900   Gene: ENSMPUG00000010989   Transcript: ENSMPUT00000011082
Sequence length 159
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:2883060:2928657:1 gene:ENSMPUG00000010989 transcript:ENSMPUT00000011082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKMHIKKLEEQDR
RALSIKEQLQREHRFLKRRLEQLSMQSLERVRTDSTGSAVSTDDSEQEVDVEGMEFGPGE
LDSVGSSSDADDHYSLQSGGCGDGGYRPPCRRPGRPGLS
Download sequence
Identical sequences M3YHU3
ENSMPUP00000010900 ENSMPUP00000010900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]