SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010920 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010920
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.5e-20
Family FHA domain 0.0031
Further Details:      
 
Domain Number 2 Region: 113-183
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000376
Family BRCT domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010920   Gene: ENSMPUG00000011009   Transcript: ENSMPUT00000011102
Sequence length 749
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897024.1:5575310:5630457:-1 gene:ENSMPUG00000011009 transcript:ENSMPUT00000011102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKLLPVAGPAREPFRLLTGVEYVVGRKNCGILIEGDQSISRNHAVLTANFSVTNLSQIG
ETPILTIKDNSKYGTFVNEEKMQNGLSQALKTGDRVTFGVFESKFRVEYEPLVACSSCLD
ASGKTALNHTILQLGGHTVNNWTEECTHLVMISVKVTIKTICALICGRPIVKPEYFAEFL
KAVKSNKQPPQIESFYPPIDEPAIGNKNIDLSGRQERKQIFKGKTFVFLNAKQHKKLSSA
VVFGGGNARLITEENEEKDSFFSAPGICVVDVGITSSQILIPDSQIKWIHSIMDQLQRQG
LRPIPEAEIGLAVIFMTTENYCDPQGQPNTALKRTPGPGLSQGLSVNENLVPSAPLNTTT
YVADTESQADTCMDFSERPKEISRVEQKFRMPSQETPTMKESPKISSDDNDAVSDTMERL
KIPTCQLSPTKFSGVNKSRDQPFQRLQTNSIKNYFQPSTKKRERDEENQDISSPKSARIE
MSCSLLEQTQPSAPSVWKNKEQHLSQNKPMEKKPDNLLTDRDLKSTVKNFANQFLSSEKL
RSEKRKEIDDLAIEDEVLDQLFKNTKSELEIGVKVEKQEEVVNIRKKPRLDIETNGTFNE
AVSENNRISQENEIGKKCELKKDSLWSTKEELSIKDELQDDSDMLPRKVLLTEFRSLVVS
NSPSRNASSVNNDYSQLKNFKKFKKVTFLGAGKLPHIIGGSDLIAHHARKNAELEEWLRQ
EMEVQNQHAKEESLADDLFRYNPNVKRRR
Download sequence
Identical sequences M3YHW3
ENSMPUP00000010920 XP_004767035.1.14098 ENSMPUP00000010920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]