SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010943 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010943
Domain Number 1 Region: 378-660
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.96e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000921
Further Details:      
 
Domain Number 2 Region: 201-375
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.14e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00015
Further Details:      
 
Domain Number 3 Region: 662-770
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.11e-27
Family Anticodon-binding domain of Class II aaRS 0.0015
Further Details:      
 
Domain Number 4 Region: 140-200
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000194
Family TGS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010943   Gene: ENSMPUG00000011032   Transcript: ENSMPUT00000011125
Sequence length 779
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896971.1:6608011:6670298:-1 gene:ENSMPUG00000011032 transcript:ENSMPUT00000011125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEAVASRLERQEEDIRWLWAEVQRLRDEQLNAPDRGQAEGRCLTREVAQLRAENRDLR
HHLYRLRLCLAEELSRQAKLESAAPAAEAQEATRAAAGAQVTNQPDFVKERLKLFEILKK
DHQLPFAVTDKKGNTNNVITVRVADGRTVKGEVWKTTPYQVAAEISPELAESAVVAKVNG
ELWDLDRPLEGDSILELLTFDNEEAQAVYWHSSAHVLGEAMELYYGGHLCYGPPIENGFY
YDTFIGDRAVSSTELSALEDICKTIIKEKQPFERLEVSKEVLLEMFKYNKFKCRILNEKV
NTPTTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPKMETLQRIYGISFPD
NKMMKTWEKFQEEARNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLMDFIREEY
HRRNFTEVLSPNMYNSKLWETSGHWQHYSENMFTFDIEKDTFALKPMNCPGHCLMFAHRP
RSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEINGCLQFLQ
SVYSTFGFSFQLNLSTRPENFLGEVEIWDEAEKQLQNSLVEFGKPWKMNPGDGAFYGPKI
DIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDGDDKRNPVIIHRAVLGSVERMIAIL
SENYAGKWPFWLSPRQVMVIPVGPTCEKYALQVSRAFFEEGFMADVDLDHSCTLNKKIRN
AQLAQYNFILVVGEKEKTNNAVNVRTRDNKIHGEVSVASAIDKLKNLKKSRTLNAEEDF
Download sequence
Identical sequences M3YHY6
ENSMPUP00000010943 ENSMPUP00000010943 XP_004759904.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]