SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010944 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010944
Domain Number 1 Region: 699-831
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000865
Family Synaptotagmin-like (S variant) 0.0066
Further Details:      
 
Domain Number 2 Region: 7-42
Classification Level Classification E-value
Superfamily WW domain 0.00000000000292
Family WW domain 0.0011
Further Details:      
 
Domain Number 3 Region: 57-91
Classification Level Classification E-value
Superfamily WW domain 0.00000000122
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010944   Gene: ENSMPUG00000011033   Transcript: ENSMPUT00000011126
Sequence length 1191
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896957.1:2063647:2244206:1 gene:ENSMPUG00000011033 transcript:ENSMPUT00000011126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPLSFADCVGDELP
WGWEAGFDPQIGVYYIDHVNKTTQIEDPRKQWRGEQEKMLKDYLSVAQDTLRTQKELYHV
KEQRLALALDEYVRLNDAYKEKSSSHTSLFSGSSSSTKYDPDILKAEISTTRLRVKKLKR
ELSQMKQELLYKEQGFETLQQIDKKMSGGQSGYELSEAKAILTELKSIRKAISSGEKEKQ
DLMQSLAKLQERFHLDQSIGTSEPDLRSSPVNSNLSLSRQTLDAGSQTSISGDIGVRSRS
NLAEKVRLSLQYEEAKRSMANLKIELSKLDSETWPGALDIEKEKLMLIHEKEELLKELQF
VTPQKRSRDELERLEAERQRLEEELLSVRGPPSRALAERLKLEERRKELLQKLEESTKLT
TCLHSQLKSLSASTLSMSSGSSLGSLASSRGSLNTSSRGSLSSLSSGELYYTSQSDQTDT
DYQCKLDLLLQEKGGYIPSGPITTIHENEVVKSPSQPGQSGPCGAVAAAAGHTPPRTEAP
KSVTSLSSRSSLSSLSPPGSPLVLEGTFPMSAHDVPLHRFTADFEDCELSGHFADLSLGE
SQILLDSHSGGVSQPLAEDKDLGECAQEPSYEGTADVEKSLPKRRASHLLGEKTACVSAA
VSDESVAGDSGVYEAFVKQPSEAEDVPYSDGDVTIVETAQVQIGLRYDAKRSSFMVILAQ
LRNLHAFLIPHTSKVYFRVALLPSSADVSCLFRTKVHPATECILFNDVFRVAISQTALQQ
KTLRVDLCSVSRHWSEECLAGTQISLADLPFSSEIFTLWYNLLPSKQMSCKKNDEGNEDS
VFQTTQSLIDAIDLDAVSTLLARTSAELLAVERQLAREEEEEEPGQEEEQRGPDGDWLAM
LREASDEVAAEEKAEVKLPEDGSRSAGSCSCPPSAPELEEDAGGRDRSCAEARGYPPPAG
PRTLVDKETNTEEAGDPGVAVRPKDRSGLSARQRPFVRSSVIVRSQTFSPGERNQYICRL
NRSDSDSSTLAKKSLFVRNSTERRSLRVKRTVCQPVLRRTAQEHPGRTSLDLELDLQASL
TRQSRLNDELQALRGLRQKLEELKAQGETDLPLGVLEDERFQKLLKEAEKQAVAQSVELP
STRVQIGEPPTTSPPAYRPPVSKEHGHQREWSVSAQRLSLSQRETWQINTI
Download sequence
Identical sequences M3YHY7
ENSMPUP00000010944 ENSMPUP00000010944 XP_004757748.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]