SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010960 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010960
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily Lysozyme-like 1.67e-20
Family G-type lysozyme 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010960   Gene: ENSMPUG00000011050   Transcript: ENSMPUT00000011143
Sequence length 197
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896935.1:4461095:4466451:1 gene:ENSMPUG00000011050 transcript:ENSMPUT00000011143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLWLLLGLLALTDLSESSNWGCYGNIRNFETPGASCGIGKRHGLNYCGVRASERLAEI
DMPYLLRYQPVIRTAGQKYCVDPAVIAGVLSRESHGGNVMTNVGNMGDGIGAVQDLGLYA
PTSWISESRVSQITEVLTVRIKEIQRRFPTWNSDQYLRGGLCAYAGAPEYIRSSQDLSCD
FCNDVLARAKYFKRHGF
Download sequence
Identical sequences M3YI03
ENSMPUP00000010960 XP_004752926.1.14098 ENSMPUP00000010960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]