SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010961 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010961
Domain Number 1 Region: 333-404
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-23
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 93-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000256
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010961
Domain Number - Region: 206-319
Classification Level Classification E-value
Superfamily Prefoldin 0.000942
Family Prefoldin 0.0084
Further Details:      
 
Domain Number - Region: 110-174
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0654
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010961   Gene: ENSMPUG00000011051   Transcript: ENSMPUT00000011144
Sequence length 447
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:4357746:4364271:1 gene:ENSMPUG00000011051 transcript:ENSMPUT00000011144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSNCSASIKSCPRPSSVCSSSMSCRPEMCLGYVCQPVSCVPSVSVPTTYRPASCFSKTY
LSSSCWSSSCRPSSGISSSMGTCSWFCEGSFNGNEKETMQSLNDRLACYLEKVRQLEREN
AELESKIQEACQSQVATMSPDYQSYFRTIEELQQKVLCTKAENARMVVHIDNAKLAADDF
RTKYETELTMRQLVEADTNGLRRILDELTLCKADLEAQVESLKEELLCLKKNHEQEVSAL
RCQLGDRLNIEVDAAPPVDLNRMLEEMRCQYETVVEANLRDVEEWFNTQMEELNQQVATS
SEQLQSYQSDIIDLRRTVNTLEIELQAQHSLRDSLESTLAETEARYGSQLAQMQCLISNV
EAQLAEIRCDLERQNQEYKVLLDVKARLECEINTYRGLLESEDCKLPCNPCSTPSCPPCA
PSPSMPRTVCVPRTVCVPCVPCPQSRF
Download sequence
Identical sequences M3YI04
ENSMPUP00000010961 ENSMPUP00000010961 XP_004772808.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]