SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010974 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010974
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily PH domain-like 0.00000477
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010974   Gene: ENSMPUG00000011063   Transcript: ENSMPUT00000011157
Sequence length 178
Comment pep:novel scaffold:MusPutFur1.0:GL898727.1:21:3380:-1 gene:ENSMPUG00000011063 transcript:ENSMPUT00000011157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGVQ
ENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYL
YSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWL
Download sequence
Identical sequences M3YI17
ENSMPUP00000010974 ENSMPUP00000010974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]