SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010983 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010983
Domain Number 1 Region: 45-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-271
Family Motor proteins 0.000000000163
Further Details:      
 
Domain Number 2 Region: 1212-1309
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-28
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1392-1511
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1795-1864,1907-1951
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-18
Family Second domain of FERM 0.0073
Further Details:      
 
Domain Number 5 Region: 1330-1384
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000226
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1175-1213
Classification Level Classification E-value
Superfamily PH domain-like 0.000000178
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000010983
Domain Number - Region: 819-921,1215-1240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0115
Family BAR domain 0.061
Further Details:      
 
Domain Number - Region: 1702-1788
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0165
Family Ras-binding domain, RBD 0.028
Further Details:      
 
Domain Number - Region: 1955-2041
Classification Level Classification E-value
Superfamily PH domain-like 0.0676
Family Third domain of FERM 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010983   Gene: ENSMPUG00000011073   Transcript: ENSMPUT00000011167
Sequence length 2082
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896975.1:2046499:2282392:1 gene:ENSMPUG00000011073 transcript:ENSMPUT00000011167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNFFPEGTRVWLRENGQHFPSTVNSCAEGVVVFRTDYGQVFTYKQSTITHQKVTAMHPM
NEEGVDDMATLTELHGGSIMHNLYQRYKRNQIYTYIGSIIASVNPYKTIAGLYERATMER
YSRCHLGELPPHVFAVANECYRCLWKRHDNQCVLISGESGAGKTESTKLILKFLSVISQQ
SLELSLKEKTSCVEQAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLHICQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEQREEFYLSAPENYHYLSQSGCIEDKTI
NDQESFREVITAMEVMQFSKEEVREVLRLLAGVLHLGNIEFITAGGAQVSFKTALGRSAE
LLGLDSAQLTDALTQRSMFLRGEEILTPLTVQQAEDSRDSLAMALYARCFEWVIKKINSR
IKGKDDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHNQHANNHFYVKPRVA
VNHFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTL
KCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNTQKMPEQFDQAVVLNQLRYS
GMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNAAVPEDIRGKCTALLQLYDASHSEWQLG
KTKVFLRESLEQKLEKQREEEVTRAAMVIRAHILGYLARKQYRKVLDCVVIIQKNYRAFL
LRRRFLHLKKAAVVFQKRLRGQIARRIYRQLLAEKREEEEKRKREEEERERERARREAEL
RAQQEEAARKQQELEALQKSQREAELRRDLEKQKENKQVEEILRLEKEIEDLQRMKERQE
LSLTEASLQKLQRLRDEELRRLEDEACRAAQEFLESLNFDEIDECVRNIERALSVGSGER
ALSVGSGVSAELEEPAEGAGAEKPSFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHS
DQRTSGIRTSDESSEEDPYMNDTVVPTSPSADSTVLLAPSEHGSSPGEPTYCMPQGGGGA
GGLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRCSVGTYNSSGAYRFSSE
GAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVL
KDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSRLMYFENDSEDKLKG
TLEIRTAKEIIDNTSKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIREM
HDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLL
QRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKL
GTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTK
APIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRHTHHPLHSPLLPLPYGDINLNLLKD
KGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTTKVPH
PGSVGNLCSWQILTCLSCTFLPSRGILKYLRFHLRRIREQFPGTEMEKYSLFIYESLKKT
KCREFVPSRDEIDALIHRQEMTSTVYCHGGGSCKITVTSHTTAGEVVEKLIRGLAMEDSR
NMFALFEYNGSVDKAIESRTIVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPK
DSVEFAFMFEQAHEAVLRGHYPAPEENLQVLAALRLQYLQGDYSLHASVPPLEDVYSLQR
LKARISQSTRSFTPCERLEKRRTSFLEGTLRRSFRTGAVVRQKVEEEQMLDMWVKEEVSS
ARANIIDKWKKLQGMSQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQDLWLGVSADA
VSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISM
IVKKRYSTSRSVSSQGSSRGRGKEPPVVQVPLKGQPAVMCSR
Download sequence
Identical sequences M3YI26
ENSMPUP00000010983 ENSMPUP00000010983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]