SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010998 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010998
Domain Number 1 Region: 343-413
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.49e-22
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 102-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000241
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010998   Gene: ENSMPUG00000011088   Transcript: ENSMPUT00000011182
Sequence length 436
Comment pep:novel scaffold:MusPutFur1.0:GL897072.1:4392752:4396418:1 gene:ENSMPUG00000011088 transcript:ENSMPUT00000011182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSCYISSSQCPGSTRLPAPTSVYGPSMDLVTQPGAEARAASLCLSATVAHANRPRVGAT
PLGKPSLCMPFSCCTACPLPGTCNIPGNIGVCENYAEGAPNGHEKVTMKFLNDRLANYLE
KVRQLERDNEELEIKIRESSKCHESTICPDYQSYFQTIKELQQKILCSKAENTRMIIQVD
NAKLAADDFRIKHESEHALRQVIEADMCGMHKLMDDLSLAKADLEAQQESLKEELLCLKK
NHEQEVSILRSQLGDKLQIKLDVEPTVDMSRVLQEMRCHYEAMVQTNHNDLEEWFQDQSE
SISKQDMSCSEELRCCQSEILELRRTVNALEVELQAQHTLKDCLQNSLCEADARFGTELA
QMQVLISNVEEQLSEIRGDLERQNQEYQVLLDVKARLECEIATYRKLLESEDCKLPMNPC
SMAASCVLCPGCAPAT
Download sequence
Identical sequences M3YI41
ENSMPUP00000010998 ENSMPUP00000010998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]