SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011019 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011019
Domain Number 1 Region: 212-552,633-657
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.27e-94
Family Myotubularin-like phosphatases 0.00000749
Further Details:      
 
Domain Number 2 Region: 35-180
Classification Level Classification E-value
Superfamily PH domain-like 7.25e-27
Family GRAM domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011019   Gene: ENSMPUG00000011109   Transcript: ENSMPUT00000011203
Sequence length 766
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896971.1:8055142:8104976:-1 gene:ENSMPUG00000011109 transcript:ENSMPUT00000011203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKPPRPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIATDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTVNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSANKINGVPSGGGSGAGSTQKTPLFETYSDWDREIKRTGASGWRVCSINEGYM
ISTCLPEYFVVPSSLADQDLKIFSHSFVGRRMPLWCWSHSNGSALVRMALIKDVLQQRKI
DQRICNAVTKSHPQRSDVYKSDLDKTLPNIQEIQAAFVKLKQLCVNEPFEETEEKWLSSL
ENTRWLEYVRAFLKHSAELVYILESRHLSVILQEEEGRDLSCIVASLVQVMLDPHFRTIA
GFQSLIQKEWVMAGYQFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPAAFEFSETYLA
VLYDSTRISLFGTFLFNSPHQRVKQSTEFAISRNIQLGDEKGLKFPSVWDWSLQFTAKDR
TLFHNPLYIGKSTPCVQNGSVKSFKRTKKSYSSTLRGMPASLKNGIIGDQDLVPRRNSLI
LKAKPDPPQQPDGQRSRMERYFREWFSKPADLHGVLLPHLSGTHVKLWKLCYFRWVPEAQ
INLGGFITAFHKLSLLADEVDVLSRTLRQQRAGPLEACYSELDKSRLYFRASGPHDASAT
PDFLSSSFPFSPVGNLCRRSISGTPLSKFLSGAKIWLSTETLANED
Download sequence
Identical sequences M3YI62
ENSMPUP00000011019 XP_004759919.1.14098 ENSMPUP00000011019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]