SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011053 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011053
Domain Number 1 Region: 51-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000436
Family Synaptotagmin-like (S variant) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011053   Gene: ENSMPUG00000011144   Transcript: ENSMPUT00000011238
Sequence length 939
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896935.1:5124310:5181306:-1 gene:ENSMPUG00000011144 transcript:ENSMPUT00000011238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSL
DRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQIKLSVY
DVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQR
PPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDG
NHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGDLSPCWESLRRQIVTQYQT
IILTYQENLTDLHQYKGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGGSDQNYDIITI
GAPAAHCQGFKSGGLRKKLHKFEETKKHSFEECCTPSSCQSIIYIPQDIIRAKEIIAQIN
TLKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARP
DYIASKASPTSSEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLE
CIIQRVDKLLQKERLHGEGCEDVFPCAGSCTSKKDCSPPPDESSPGEWSEALYPLLTTLT
DCVAMMSDKAKKAMVFLLMQDSAPTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLH
DDGFLRQLYTIGLLAQFESLLSTYGEELAMLEDMSLGIMDLRNVTFKVTQATSNASTDML
PVITGNRDGFNVRIPLPGPLFDALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSL
QEVINVESLVRLNSYFEQFKEVLPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILW
QAAEVCRRLNGVRFTSCKSAKDRTAMSVTLEQCLILQHEHGMAPQVFTQALECMRSEGCR
RENTMKNVGSRKYAFNSLQLKAFPKHYRPPEGTYGKVET
Download sequence
Identical sequences M3YI96
ENSMPUP00000011053 ENSMPUP00000011053 XP_004752955.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]