SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011066 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011066
Domain Number 1 Region: 437-1006,1051-1219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-210
Family Motor proteins 0.0000000145
Further Details:      
 
Domain Number 2 Region: 107-345
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.54e-54
Family Ankyrin repeat 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011066   Gene: ENSMPUG00000011157   Transcript: ENSMPUT00000011251
Sequence length 1789
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896915.1:3368697:3789103:-1 gene:ENSMPUG00000011157 transcript:ENSMPUT00000011251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFLGTMVVAEENARTPSRIAVGAGKMSHYHFIKCCCFQLCNVFRTHEMEIDQCLLESLP
LGQRQRLVKRMRCEQIKAYYEREKAFQKQEGFLKKLKHGKSQKVHFNLADMIQDAIIHHD
DKEALRLLKEGADPHTAVSSGGSLLHLCARYDNAFIAEILIDRGVNVNHQDEDFWTPMHI
ACACDNPDIVLLLVLAGADVLLQDVNGNIPLDYAVEGTESSFILLTYLDEHGVDLTSLRQ
MKLQRPLAMLTDVKHFLSGGGNVDERNDEGVTLLHMACASGYKEVVALLLEHGGDLNVTD
NQYWTPLHLAAKYGQTNLVKLLLMHQANPNLLNCNEEKPSDIAASEFIEEMLLKAEVAWE
ERVKERLCVPALASEEPYEEILHDLPALSSKLSPLVLPIAKQDSMLEKDIMFKDATKGLC
KRQSQDSIPENATVNGPTKPEPVKLMPPAPSDDLATLSELNDGTLLYEIQKRFGNNQIYT
FIGDILLLVNPFKELPIYSTMVSQLYLSSTGQPCSSLPPHIFSCAERAFHQLFQEQRPQC
FILSGERGSGKSEASKQIMRHLTCRSGSRRPMLDSKFKHVMCILEAFGHAKTTLNDLSSC
FIKYFELQFCERKKHLTGARIYTYMLEKSRLVSQPLGQSNFLIFYLLMDGLSAEEKYGLH
LSNLHAHRYLNQTRPEDVSTAELSLNREKFTLLKQALNVIGFSHLEVENLFVILAAILHI
GDIRFTALTEANSAFVSDLQLLEQVAGLLQVSTDELLSALTTDIQYLKGDTIIRRHTVEM
AEFYRDLLAKSLFGRLFSFLVNTMNGCLYSPDEHSSPQTLDIGILDIFGFEEFQKNEFEQ
LCVNMTNEKMHHYINEVLFLHEQTECVQEGVTMETAYSPGNQTGVLDFFFQKPSGFLSLL
DEESQMIWSMEPNLPKKLQSLLESSNTNAVYSPMKDGNGNMALKDQGTAFTTMHYAGRVM
YEIVGAIEKNKDTLSQNLLFVMKTSENVVIHHLFQSKLSQTGSLVSSYPSFKFRGQKSTL
LSKKTAASSIIGENRNYLELSKLLKKKGTSTFLQRLERGGPVTIASQLRKSLTDIIGKLQ
KRTPHFIHCIKPNNSRLPDTFDNFYVSAQLQYIGVLDMVKTIRYGYPVRLSFSDFLSRYK
PLAHTLPGEKQPLSAAEKCRLVLQRCKLQGWQMGVRKVFLKYWHADQLNDLCLRLQRKII
ICQKVVRGFLARQHLLRKRSIRQQEVTSINSFLQITEDMGLKTYDALVIQNASDIAREND
RLRNEMNATSHKVKVDAGHKPEAGTRRAEDRAGPRHCHYSCVPGPLAADGLIQALAGPSA
RSPSLHSVSSLDDGSSLPSPRKQPPPKPKRDPTTRLSASYEAVSACLWAAARESAGEGLT
RPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSSEEITGARRRGGPQRAPGIPAPPAPPTRA
PPEPEPEPVYIEMVGRAGSPEQAEAVYEEMKYFAPPEASASPPLLSDTRNPVSSEDGEGG
GQAAAGPCKDACDIPAPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLET
NLKYPVQAEGSSPLSPQHAKNQKSDGDRPASPCPLAASGSPPTPPPPPAPPAPRPPTHFA
FPPEPLGNAGRAAGPSPEAPRAPQPPNSAPAGGPCSSFSKAPYSPGRAARAGHRKASASP
SSPVPFSPPNCRALGSPLDELTSLFSSGRSVLRRSAAGRRIREPEGFETNMNLTAREDAG
RSEIASETQDRNANNHGIQLSNSLSSAITAENGNSVSNGKCFLNSEVNR
Download sequence
Identical sequences M3YIA9
XP_012908533.1.14098 ENSMPUP00000011066 ENSMPUP00000011066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]