SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011085 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011085
Domain Number 1 Region: 153-282
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.12e-44
Family Synaptotagmin-like (S variant) 0.00000444
Further Details:      
 
Domain Number 2 Region: 291-427
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.69e-41
Family Synaptotagmin-like (S variant) 0.000000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011085   Gene: ENSMPUG00000011176   Transcript: ENSMPUT00000011270
Sequence length 495
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896951.1:5963091:6006769:-1 gene:ENSMPUG00000011176 transcript:ENSMPUT00000011270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGGWAKERGFAAVISSATMRNIFKRNQEPIVAPATTTATISTGLLDNSTESGGAGESK
EDMFATIKDKFFNEIQKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGK
GMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGV
LQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGK
TLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRY
VPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNES
FSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIA
QWHSLKPEEEVDALLGKNKKPSLARFLQNQFGLMLLAQGSSEREKRGCSGPPVGKTSSPR
GETPPGAGSERFHGC
Download sequence
Identical sequences M3YIC8
ENSMPUP00000011085 ENSMPUP00000011085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]