SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011097 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011097
Domain Number 1 Region: 20-154
Classification Level Classification E-value
Superfamily Lipocalins 7.7e-23
Family Retinol binding protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011097   Gene: ENSMPUG00000011189   Transcript: ENSMPUT00000011284
Sequence length 178
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896954.1:226816:229186:1 gene:ENSMPUG00000011189 transcript:ENSMPUT00000011284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGLLTVVLGVVVVQAHTASQDLHLQKIAGFWREVGVASSQNLALKTPKRLEALFLTLS
GRELTVKVAYNSSGSCETEKIVGSEIDVSGTFAFPGHREIHVIDTDYEQYAILRLSLRWQ
GKDYYVLKYFTRSLEDEYGPGFRRFRDLTADMGLYLVARHGRCAELLKEVSLAPGCAG
Download sequence
Identical sequences M3YIE0
ENSMPUP00000011097 ENSMPUP00000011097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]