SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011138 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011138
Domain Number 1 Region: 539-566,609-692
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011138   Gene: ENSMPUG00000011230   Transcript: ENSMPUT00000011325
Sequence length 706
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:3945034:3947833:1 gene:ENSMPUG00000011230 transcript:ENSMPUT00000011325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSAEGAPQGTGPVLVRRRSPRSLGLREMLKARLWCSCTCSTQRAWTLVQDLLPATRWL
RQYHPREALVGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSHH
VSVGIFSLLCLMVGQVVDRELLLAGFGPAQEGPGPGDNSSTINTSAAVAGLRPQDCDQDC
YAIRVATALTLVAGIYQVLLGMLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVR
IPRHQGLGMVVSTWLSLVRGAGQANLCDVVTSATCLAVLLAGKELSERCQRRLKVPLPTE
LVVIVAATMVSHFGQLHERFGSSVAGDIPTGFVAPRVPDPGLMWRVVLDAVPLALVGSAF
SISLAEMFARSHGYSVRANQELLAVGCCNVLPAFFHCYVTSAALSKTLVKTATGCRTQLS
SVVSAAVVLLVLLALAPLFRDLQRCVLACVIVVSLRGALRKVRDVPQLWRLSPADALVWV
ATAATCALVSVEVGLLAGILLSLLSLAGRTQRPRAALLAQIGDSGFYEDAAEFEGLVPEP
GVRIFRFAGPLYYANKDFFLRSLSSLTGLDAGRAATRKKERGLEARVSEGDPVEGMDLGP
ETSTAALVSTAAGFHAVVIDCAPLLFLDAAGVATLRDLRRDYAALGVMLLLACCSPLVRD
TLRRGGFLGEDQGDLTEDGQLFHSVHSAVQRARARHRVPAATDSAL
Download sequence
Identical sequences M3YII1
ENSMPUP00000011138 XP_004772389.1.14098 XP_012901277.1.14098 ENSMPUP00000011138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]