SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011193 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011193
Domain Number 1 Region: 1026-1095
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000733
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 2 Region: 900-977
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000243
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 
Domain Number 3 Region: 1107-1179
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000126
Family Pointed domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011193   Gene: ENSMPUG00000011285   Transcript: ENSMPUT00000011381
Sequence length 1267
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896951.1:6368008:6417354:1 gene:ENSMPUG00000011285 transcript:ENSMPUT00000011381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTPTMCEVMPTINEGDPLGPPHGADADANFEQLMVNMLDEREKLLESLRESQETLAATQS
RLQDALHERDQLQRHLNSALPQVVGGETEGSLSGPCLANPEEFATLTRELSMCREQLLER
EEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSL
FEHHKALDEKVRERLRAALERVTTLEEQLAGAHQQVSALQQGAGVRDGVVEEEGTVERGP
KRLWKGGGLPWARRLTHGSLSPEDDTGQVEELQELLEKQNFELNQARERLVTLTATVAEL
EEDLGTARRDLIKSEELSSKHQRDLREALAQKEDMEERITTLEKRYLAAQREATSIHDLN
DKLENELANKESLHRQCEEKARHLQELLEAAEQRLQQTMRKAETLPEVEAELAQRIAALT
KAEERHGSIEEHLRQLEGQLEEKNQELARVRQREKMNEDHNKRLSDTVDRLLSESNERLQ
LHLKERMAALEEKNTLIQELESSQRQIEEQHHHKGRLSEEIEKLRQEVDQLKGRGGPFVD
GVHSRSHMGSAGDVRFALSTATHVPSGLHRRYSALRDESAKGGRRRGEVELAGFLEHEDW
EPSPLPGGLAPTAAPAFDSDPEISDVDEDEPGGLVGSVDVVSPSGHSDAQTLAMMLQEQL
DAINEEIRMIQEEKESAELRAEEIETRVTSGSMEALNLTQLRKRGSIPTSLTALSLASAS
PPLSGRSTPKLTSRSAAQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETS
PPSSPRTLRLEKLGHPALSQEEAPSWLSSCSALEDQGSNPSSSNSSQDSLHKGAKRKGIK
SSIGRLFGKKEKGRLIQLFMLTDSELGLQEPMVPAKLGTQAEKDRRLKKKHQLLEDARRK
GMPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHR
LKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLATPTKTDSEEGSWAQSALFLQ
TLAYGDMNHEWIGNDWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRT
SLQYGIMCLKRLNYDRKELEKRREESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLQES
GVHGALLALDENFDHNTLALVLQIPTQNTQARQVMEREFNNLLALGTDRKLDDGEDKVFR
RAPSWRKRFRPREPHGGLLGASAETLPAAFRVASLGPLQPPPAPPKKVTPEARSHYLYGH
MLSAFRD
Download sequence
Identical sequences M3YIN6
ENSMPUP00000011193 ENSMPUP00000011193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]