SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011214 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011214
Domain Number 1 Region: 1-234
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-48
Family Protein kinases, catalytic subunit 0.00048
Further Details:      
 
Domain Number 2 Region: 1053-1218
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.32e-43
Family Chaperone J-domain 0.000000662
Further Details:      
 
Domain Number 3 Region: 319-473
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-27
Family Dual specificity phosphatase-like 0.0001
Further Details:      
 
Domain Number 4 Region: 483-620
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.14e-18
Family PLC-like (P variant) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011214   Gene: ENSMPUG00000011306   Transcript: ENSMPUT00000011402
Sequence length 1219
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897070.1:4006372:4050710:1 gene:ENSMPUG00000011306 transcript:ENSMPUT00000011402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLSGHPNIVQFCSAASVGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTV
LKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSA
QRRALVEDEITRNTTPMYRTPEMVDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAK
LRIVNGKFSIPPNDTRYSVFHDLIRATLKVNPEERLSITELVNQLQEIAAARNVNPKSPI
TELLEQNGGYGNAVPSRGPPLPGGSSSSGYSGGLALAEYDQPYGGLLDILRGGTERLFTN
IKDTSSKVIQSVANYAKGDLDISYITSRIAVMSFPAEGVESAIKNNIEDVRLFLDSKHPG
HYAVYNLSPRTYRSSKFHNRVSECGWAARRAPNLRSLYSVCRNMHSWLRQDHKNVCVVHC
MDGRAASAVAVCSFLCFCRLFTTAEAAVYMFSMKRCPPGIWPSHKRYIEYMCDMVAEEPI
TPHSKPILVKAVVMTPVPLFSKQRNGCRPFCEVYVGDERVTTTSQEYDKMRDFKIEDGKA
VIPLGITVQGDVLIIIYHARSTLGGRLQAKVASMKMFQVQFHTGFVPRNATTVKFAKYDL
DACDIQEKYPDLFQVNLEVEVEPRDRPSREAPPWESTSMRGLNPKILFSSREEQQDILSK
FGKPELPRQPGSTAQYDADAGSLDAEPTESDSPQSSSTDSSRFLHTLDWHEEKDPETGPE
GRFAKESASAPAEDAAGSEPSDEEAVTLSAESRDAAEEDTPGPAVRVQERELIFDAVTPA
TPQEPTLQEDSVDLLGLNSEAGLAPPSQACGAASSTADLLSCLLGAPDTAPEVPSGDLLG
GEAPLLFASPAPSLSAQSPPQEGQATAADPFDPLLLPSGSSSQPCSKPDLFGELLNSESP
ATAPASFPSTHSAPPPACSADFLHLGDLPVEPGKMTASTSHPDLLGGWEDWAEAPTPSTT
AEGPFFSPGGQPTAPGPPAGWTKSQSLDPFADLGDLSSGLQGAPAGFAPGGFGPKTVPPP
TGSSSWQQTSRPPAQGTPRPPQAKPPLKTSAQPRPNYAANLSVIGSREERGVRAPSFGQK
PRVSESDFEDLLSDQGFSSKADRKGPRTMAEMRRQEQARDTDPLKLKLLEWTEGKERNIR
ALLSTLHTVLWDGESRWTPVGMADLVSPGQVKKHYRRAVLVVHPDKAAGQPYEQYAKMIF
MELNDAWAEFESQGSRPLF
Download sequence
Identical sequences M3YIQ7
ENSMPUP00000011214 ENSMPUP00000011214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]