SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011291 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011291
Domain Number 1 Region: 493-627,654-792
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.3e-68
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 186-476
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.56e-66
Family Ankyrin repeat 0.000012
Further Details:      
 
Domain Number 3 Region: 802-945
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-39
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 1106-1309
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.4e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.002
Further Details:      
 
Domain Number 5 Region: 1027-1088
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000334
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011291   Gene: ENSMPUG00000011383   Transcript: ENSMPUT00000011479
Sequence length 1327
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896957.1:5810997:6012982:-1 gene:ENSMPUG00000011383 transcript:ENSMPUT00000011479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTAGGLAPFASPR
HGLALPEGDGSRDPPDRPRSPDPVDSTSCCSTTSTICTVAAAPVAPAVSASSAVGVAPNP
AGGGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSTTATLGPGAAGPGPGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGA
NVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIV
LLQHGADPNIRNTDGKSALDLADSSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNV
NCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTEL
LLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPEL
RERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQV
TELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAAL
AGHLQTCRLLLTYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKA
GDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVP
LHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKN
RDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTP
LHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATD
KWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEA
LPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGPSNTGDGAAGAERK
EGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLI
KGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGG
IFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER
HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSF
LQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPAQSA
TAAEQKT
Download sequence
Identical sequences M3YIY4
XP_004757866.1.14098 ENSMPUP00000011291 ENSMPUP00000011291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]