SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011326 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011326
Domain Number 1 Region: 165-292
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-24
Family Pleckstrin-homology domain (PH domain) 0.00000111
Further Details:      
 
Domain Number 2 Region: 846-916,985-1059,1130-1170,1292-1315,1391-1530
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000187
Family Mo25 protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011326   Gene: ENSMPUG00000011418   Transcript: ENSMPUT00000011514
Sequence length 2094
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896915.1:11910397:12083409:1 gene:ENSMPUG00000011418 transcript:ENSMPUT00000011514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQADKCRTSSRSVKKELVIESPLQRKDAAQGEEEAEGAGPVLAKPKLIEPLDYENVIVQK
KTQILNDCLREMLLFPYDDFQTATLRRQGRYMCSTVPADAQEEAQSLFVTECIKTYNSDW
HLVNYKFEDYSGEFRQLPNKVAKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGWL
YKGNMNSAISVTMRSFKRRFFHLLQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVIQN
NKVRRFAFELKMQDKSSYLLAADSEAEMEEWITILNKILQLNFEAAMQEKRNGDSHEDDE
QSKLEGSGSGLDSYLPELAKSTREAEIKLKSESRVKLFYLDPDAQKLDFTSAEPEVKPFE
EKFGKRILVKCNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIKYNRKISADFHVDLN
HFSVRQMLAPTCPAVMNGGRQSSPTLQDILHEASMQYPKQGIFSVTCPHPDIFLVARIEK
VLQGSITHGAEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNLD
KNARFSALYRQDSNKLSNDDMLKLLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYVN
SSYIPMKQFETCSKTPVTFEVEEFVPCIPKHTQPYTIYNNHLYVYPKYLKYDSQKSFAKA
RNIAICVEFKDSDEEDSQPLKCIYGRPGGPVFIRSAFAAVLHHHQNPEFYDEIKIELPTQ
LHEKHHLLFTFFHVSCDNSSKGSTKKRDVVETQVGYSWLPLLKDGRVVTSEQQVPVSANL
PSGYLGYQELGMGRHYGPEIKWVDGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQKTESG
AQALGSELVKYLKSLHAMEGHVMIAFLPTILNQLFRVLTRATQEEVAVNVTRVIIHVVAQ
CHEEGLESHLRSYVKYAYKAEPYIASEYKTVHEELTKAMTTILKPSADFLTSNKLLKYSW
FFFDVLIKSMAQHLIENSKVKLLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASKN
ANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAPGDPKTLFEYKFEFLRVVCNHEHYIPL
NLPMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEFREVRQIAISVLK
NLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTMKEDSL
PATNPLVTPQKPGLVLDNSLHKDLFGAISGIASPYTASTPNINSVRNADSRGSLISTDSG
NSLPERNSEKSNSLDKHQQSGPLGNSVVRCDKLDQSEIKSLLMCFLYILKSMSDDALFTY
WNKASTSELMDFFTISEVCLHQFQYMGKRYIARTGMMHARLQQLGSLDNSLTFNHSYGHS
DADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFLQK
HQSETALKNVFTALRSFIYKFPSTFYEGRADMCAALCYEVLKCCNSKLSSIRTEASQLLY
FLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCANSDRLIKH
TTFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMA
RIHVKNGDLSEAAMCYVHVTALVAEYLTRKEADIALRPELPLFPSSHSTCQRRRRGGMFR
QGCTAFRVITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWKAERYELIADIYK
LIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGK
EYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIP
FFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKK
RIPVMYQHHTDLNPIEVAIDEMSKKVAEFRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPL
AYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAINERLIKEDQLEYQEEMKANY
REMAKELSAIMHEQICPLEEKTSVLPNSLHIFNAISGTPTSTMVHGMTSSSSVV
Download sequence
Identical sequences M3YJ19
ENSMPUP00000011326 ENSMPUP00000011326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]