SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011349 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011349
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 5.23e-46
Family VHS domain 0.0000584
Further Details:      
 
Domain Number 2 Region: 159-221
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011349
Domain Number - Region: 414-529
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0146
Family Arfaptin, Rac-binding fragment 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011349   Gene: ENSMPUG00000011441   Transcript: ENSMPUT00000011537
Sequence length 780
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:1123235:1139611:-1 gene:ENSMPUG00000011441 transcript:ENSMPUT00000011537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVSSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQAEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKSAYAAATYPKAEPAPVA
SSAPPASSLYSSPVTSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPAPLTEPA
APPAEGHAVPASALETPLPETDAQPVAPSSGPFGEQYQNGESEESHAQFLKALQNAVTTF
VNRMKSNHVRGRSITNDSAVLSLFQSINGMHPRLLELLNQLDERRLYYEGLQDKLAQIRD
ARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAVQRLREQ
EQERQLRLEQQKQTVQMRAQMPAFSLPYAQLQAMPAAGGVLYQPSGPTSFPGTFSPAGSV
EGSPMHTVYMSQPAAAASTPYPSMPGAATDPGMVGAYMYPAGATSAQAAPQGPAGPTASP
AYSSYQPTPTQAYQNVASRAPQSLPAVSQPPQSGAMGYMGSQSVSIGYQPYGMQSLMNTL
PSQDAPLPPPQQPYIAGQQPLYQQMAPSGGPPQQQPPVAQPPPAQGPPAQGSEAQLISFD
Download sequence
Identical sequences M3YJ42
ENSMPUP00000011349 XP_004748763.1.14098 ENSMPUP00000011349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]