SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011363 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011363
Domain Number 1 Region: 128-293
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011363   Gene: ENSMPUG00000011453   Transcript: ENSMPUT00000011551
Sequence length 363
Comment pep:novel scaffold:MusPutFur1.0:GL896907.1:284177:365631:-1 gene:ENSMPUG00000011453 transcript:ENSMPUT00000011551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLRDPSGNHTPPQLSPSLSQSTY
TTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQQSSVCEIWTNQNAGFPFSAI
HQVHNTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRG
TESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAA
QDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGH
SSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYET
TIF
Download sequence
Identical sequences M3YJ56
ENSMPUP00000011363 ENSMPUP00000011363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]