SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011374 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011374
Domain Number 1 Region: 74-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000261
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 38-70
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000471
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 8-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000314
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011374
Domain Number - Region: 104-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00428
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011374   Gene: ENSMPUG00000011464   Transcript: ENSMPUT00000011562
Sequence length 144
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896948.1:7419929:7476546:1 gene:ENSMPUG00000011464 transcript:ENSMPUT00000011562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL
ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL
KNNMILCQTDYEEGLMKEGYAPQP
Download sequence
Identical sequences A0A2I3M2T0 A0A2K5LAR8 A0A2K6K005 M3YJ67
ENSMPUP00000011374 ENSMPUP00000011374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]